SecReT6
Protein ID: 186470788
SecReT6 ID274
T6SS typei4a
Gene symbol-
Locus tagBphy_5997
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]534296..535444 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDB2JVT3
KEGG IDbph:Bphy_5997
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-22, Aligned region: 67..128
Protein Sequence: 382 a.a.     [Download]
>gi|186470788|ref|YP_001862106.1| unnamed protein product [Burkholderia phymatum STM815]
MKQSYPMDIAQGLDIDLEALLAPVPMGEGAGVSLRYEPLYQHIRDARTHDDSSVPMGEWERPLIKADWKR
VAASCTEALSTRSKDFQLAAWLCEAWTHMHRIEGFIAGTRLLTMLAESYWEHAWPALEEGDTDARVAPFV
WLNDTIALVLTLHVPLLVIEGREPANVNLDEWQRVLVEGGDDDAADLTRDLLDKHVTQGGNLASLAALHQ
QLEVAQQMWLSFGRLLDVLLQGDSPHLGRVSDVLMRLSRAVTSLLGNHALAAATGQVPHDDPAAGLMAVG
GAPSVNENYALLETQMSDALREPPVVGTSIRALPARVESRAQAYQLIEVIAQYLAEQEPHSPTPYLLRRA
ASWGQMPLPELMREVLRTEGDMSRYLAMLEIK
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|186470346|ref|NC_010625.1|:534296-535444 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAAACAGTCGTATCCGATGGACATCGCACAAGGCCTCGACATCGACCTGGAGGCGCTGCTTGCGCCCG
TGCCAATGGGCGAGGGCGCCGGCGTCTCGCTACGCTACGAGCCGCTGTACCAGCACATCCGCGACGCTCG
CACGCATGACGACTCGAGCGTCCCGATGGGCGAATGGGAACGTCCGTTGATCAAGGCGGACTGGAAGCGC
GTGGCAGCCTCATGCACGGAGGCGCTCAGCACGCGCAGCAAGGATTTCCAGCTTGCCGCATGGTTGTGCG
AAGCATGGACGCATATGCACCGCATCGAAGGTTTTATCGCGGGGACGAGGCTGCTGACGATGCTCGCGGA
AAGCTATTGGGAACACGCCTGGCCGGCGCTGGAAGAAGGCGACACGGATGCGCGTGTCGCGCCGTTCGTA
TGGCTGAACGACACGATCGCCCTTGTGCTGACGTTGCACGTGCCGCTCCTCGTGATCGAAGGGCGCGAGC
CGGCAAACGTGAATCTGGACGAGTGGCAGCGCGTCCTCGTGGAAGGAGGCGATGACGATGCGGCTGACCT
CACGCGAGACCTGCTCGACAAACACGTCACGCAAGGAGGCAACCTGGCTAGCCTGGCGGCGCTGCATCAG
CAGCTCGAGGTCGCCCAGCAGATGTGGCTGTCGTTCGGCCGCCTGCTCGACGTTCTGCTGCAGGGCGATT
CGCCTCATCTGGGCAGGGTGAGCGATGTGCTGATGCGCCTCTCGCGGGCGGTCACAAGCCTGCTCGGCAA
TCACGCATTGGCCGCTGCCACGGGTCAAGTTCCACATGACGATCCTGCGGCGGGCTTGATGGCCGTGGGG
GGTGCACCGTCGGTCAACGAAAATTACGCATTGCTGGAGACGCAAATGAGTGACGCATTGCGAGAGCCGC
CTGTCGTGGGCACGTCAATCAGAGCTCTTCCCGCCCGAGTGGAGAGCAGGGCACAAGCTTATCAACTGAT
CGAAGTCATCGCGCAGTACCTGGCCGAACAAGAACCGCATAGTCCGACGCCGTATCTGCTACGTCGTGCC
GCTTCGTGGGGGCAAATGCCGCTGCCCGAGCTGATGCGGGAGGTGTTGCGCACGGAAGGCGACATGTCGC
GCTATCTCGCGATGCTCGAGATCAAGTAA
 Primer design