SecReT6
Protein ID: 186470893
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6108
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]655657..659703 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB2JW38
KEGG IDbph:Bphy_6108
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.80E-97, Aligned region: 622..946
ImcF-related_N [PF14331], Evalue: 1.60E-92, Aligned region: 306..575
DUF1215 [PF06744], Evalue: 7.10E-34, Aligned region: 945..974
DUF1215 [PF06744], Evalue: 7.10E-34, Aligned region: 1054..1178
Protein Sequence: 1348 a.a.     [Download]
>gi|186470893|ref|YP_001862211.1| unnamed protein product [Burkholderia phymatum STM815]
MKKFLSFLVSRQFLAFLALIVVALVIWYVGPFVAFGGLKPLAGAGMRVLVIALLLAGVLLWLVRWSTSPV
IVALLCLLIWYATPLLTFGKAQPFAPESARIIAIAVALFIFAVYWLFRLWQEMKSNRSLVDRMLTFGGKK
EPSPAAVQLKEVGVIVSSALARLKAMRTGARGIGRLFQGKRYLYELPWYIALGSKSSGKTSALLNAGLAF
PVAEQMQRAAGAAQKPTANVDWWLTNDAVLIDTAGYYTRHGTSGHALPPPPESNNPTERKATDTRTENEK
SGHGKALDAPKASTASTTWADPAQARQRMDSEEWLGFLGMLRTHRPRAPINGALLAVNLGELTSQDDSSR
MAEAAALRARLAELRGELGIRFPVYLVVTGMDQLTGFAEYFSSLTAEGRAQPWGFTLPYGKETIAKEGVT
ARCRSELGQLAQRLERGIDTRLQDEYDPLHRRKLAALSQEFAALSAPLIELIERVFLDSRYDDTQLYSTL
RGVYFTSAEQAGNERVAERRTIVQRVIAGMKAPATSLREATSEGFFLHDLFTKVVIPEAHLVRPNLRWEF
RFRLLRLVGHALALLLFVWLAIGLCVSFGNNSDYLGAIARKTQALAARVAQLYHDPKAEAVPDTLSAARY
LPTYQGLDLSDPDSTFRYGLYTAPDIVTESRHIYDALEDNLLVPQIVHRMEDVISQSITNKDPKATYEAL
RVYLMLYDKAKFNADDVKAWVLDDWAKTDSASVFGGRASMIDHVQQLFSGTRVVQSPLIRNDALIQQARA
FLDGSNATDRLYERAKAAMMKEAPDEFTLIRAVGPQAGTVFTRASGAPLSRGVPGLFTFDGYRNLFDKHL
PEFVQVARDDDAWVMGRSYLGGLSDQAQKKTAELVRMATGADDPLTEAIRREYLTEYAQQWDAFLGDIRT
VRGTSLAFNLQVLRSFAAPDSPLARLARAAVHETTLTQPVAATGGSLLQKATDQISQKADSALGIRASEQ
VERELVDSRFAALREVVTGNAEGQATGDAAAQPGKTGLDGVTNLLNDYYTALTVADNAISNNSMPPASDT
AAKLKMTANTMPPPFRAVLLQLAQQGSQEVNQGIGQLLSRQMGAVIGDTCRLTIEGNYPFTPGSTRDVSI
DDFTRVFAQGGVIDDFFNKTLAPFVDTSAKPWRYRTLPGATEPVQGPDLEPFQHVKAIRDVFFSGPGQNQ
MTWKANLQVPELDPAITGLMIDIDGQTMLYQHGPVTPFTVSWPGPRGGVHAEITANPRIRPETSTMSADG
PWALMRLLAKGHVVETATPGKTLVAFDFDGRRAVLDMDSTGSVANPLTSDVLRTFRCPSSMPVFGLVDSG
PPPGLPAAGLPMTPPSPY
 
Nucleotide Sequence: 4047 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c659703-655657 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAAAAAATTCCTGTCGTTTCTGGTCTCGCGCCAGTTCCTCGCCTTTCTCGCGCTGATTGTTGTCGCGC
TGGTGATCTGGTATGTCGGACCCTTTGTCGCATTCGGCGGCCTGAAGCCGCTCGCAGGCGCAGGCATGCG
TGTGCTCGTCATCGCCCTGCTGCTCGCGGGCGTTCTGCTCTGGCTGGTCCGCTGGTCGACCAGCCCCGTC
ATCGTGGCGTTGCTGTGCCTGCTGATCTGGTACGCGACGCCGCTGCTCACGTTTGGCAAGGCCCAGCCCT
TCGCGCCGGAGTCGGCACGCATCATCGCCATCGCGGTCGCGCTGTTCATTTTCGCCGTGTACTGGCTCTT
CCGCCTCTGGCAGGAGATGAAGAGCAACCGCTCGCTGGTCGACCGGATGCTGACGTTCGGTGGCAAGAAG
GAACCGTCGCCTGCCGCAGTACAGCTGAAAGAGGTCGGCGTCATTGTGTCAAGCGCCCTCGCCCGCCTGA
AGGCGATGCGAACCGGCGCGCGTGGCATAGGACGTCTTTTCCAGGGCAAACGCTACCTGTATGAATTGCC
GTGGTATATCGCGCTCGGCTCGAAGTCTTCGGGCAAGACAAGCGCCCTGCTGAACGCGGGTCTCGCGTTC
CCTGTTGCCGAACAGATGCAGCGTGCCGCAGGCGCCGCGCAGAAGCCAACTGCCAACGTCGACTGGTGGC
TCACCAACGATGCGGTGCTGATCGACACGGCTGGCTACTACACCCGTCACGGCACATCCGGACACGCTTT
GCCGCCGCCTCCGGAAAGCAACAATCCCACGGAGCGCAAGGCTACCGACACAAGGACGGAGAACGAAAAA
TCTGGGCATGGGAAAGCCCTCGACGCGCCGAAAGCATCGACCGCGTCAACCACGTGGGCCGATCCCGCGC
AGGCTCGCCAGCGAATGGACTCGGAGGAATGGCTCGGCTTCCTCGGCATGCTTCGGACGCACCGGCCGCG
CGCACCCATCAACGGTGCGCTGCTCGCGGTCAACCTCGGCGAACTGACGAGCCAGGACGACAGCAGCCGC
ATGGCCGAAGCGGCCGCGTTGCGTGCGCGCCTGGCCGAACTGCGTGGCGAGCTCGGTATCCGCTTTCCGG
TCTATCTGGTCGTGACCGGCATGGACCAGCTCACCGGCTTCGCCGAATACTTTTCGTCGCTAACGGCAGA
GGGCCGTGCCCAGCCATGGGGTTTTACGCTTCCCTACGGCAAGGAAACCATCGCGAAAGAAGGCGTCACC
GCACGGTGCCGCTCGGAGCTGGGCCAGCTCGCACAACGCCTCGAACGTGGCATCGATACCCGCCTGCAGG
ACGAATACGATCCGCTCCACCGTCGCAAGCTCGCCGCGCTGTCACAGGAGTTTGCCGCCCTGAGCGCGCC
GCTCATCGAACTGATCGAGCGGGTGTTTCTCGATTCACGCTACGATGACACGCAGCTGTACTCGACGCTG
CGCGGCGTGTACTTCACGAGCGCAGAACAGGCTGGCAACGAGAGGGTGGCCGAGCGGCGCACCATCGTGC
AACGGGTGATCGCGGGCATGAAGGCGCCGGCAACATCGCTGCGCGAGGCAACCAGCGAAGGCTTCTTCCT
GCACGACCTCTTCACGAAGGTTGTCATTCCCGAGGCGCATCTCGTGCGCCCGAACCTGCGCTGGGAGTTC
CGCTTCCGTCTGCTACGCCTGGTTGGCCACGCGCTCGCCCTGCTGCTCTTCGTCTGGCTCGCCATTGGAC
TGTGCGTGAGCTTCGGCAACAACAGCGATTACCTTGGTGCCATTGCGCGCAAGACGCAGGCGCTCGCGGC
GCGTGTGGCGCAGCTGTACCACGACCCGAAGGCGGAAGCCGTGCCCGATACGCTGAGCGCCGCGCGCTAT
CTGCCGACGTATCAGGGGCTCGACCTGTCGGACCCCGACAGCACCTTCCGCTACGGTCTCTACACGGCCC
CCGATATCGTCACGGAAAGCCGCCACATCTATGACGCGCTTGAGGACAACCTGCTGGTACCGCAGATCGT
GCACCGGATGGAAGACGTGATCTCGCAGTCGATCACGAACAAGGATCCGAAGGCGACTTACGAGGCACTG
CGCGTCTATCTCATGCTTTATGACAAGGCGAAATTCAACGCCGATGACGTCAAGGCGTGGGTACTCGACG
ACTGGGCGAAGACCGACAGCGCATCCGTATTCGGCGGTCGCGCCTCGATGATCGATCACGTCCAGCAATT
GTTCTCCGGCACCCGGGTAGTCCAGTCGCCGCTCATCCGCAACGACGCTCTGATCCAGCAGGCCCGGGCC
TTCCTCGACGGCAGCAATGCGACCGACCGGCTCTACGAGCGGGCCAAGGCCGCCATGATGAAGGAGGCGC
CTGACGAGTTCACGCTGATCCGCGCGGTGGGCCCCCAGGCGGGGACTGTCTTCACGCGTGCAAGCGGTGC
GCCCCTCTCGCGCGGCGTGCCGGGCCTTTTCACGTTCGACGGCTACCGCAATCTTTTCGACAAACACCTG
CCCGAGTTCGTCCAGGTCGCGCGCGATGACGATGCGTGGGTGATGGGGCGCTCTTATCTCGGGGGGCTCT
CCGACCAGGCTCAAAAAAAAACTGCGGAGCTTGTAAGGATGGCCACTGGTGCCGACGATCCACTGACCGA
AGCGATCCGGCGGGAGTACCTCACGGAGTATGCCCAGCAATGGGACGCATTTCTTGGCGACATCCGCACG
GTGAGAGGGACGAGTCTTGCGTTCAACCTGCAGGTGCTGCGCAGTTTTGCTGCACCTGATTCCCCTCTCG
CGCGGCTAGCGCGCGCGGCCGTGCACGAAACGACGCTCACGCAGCCAGTCGCCGCAACCGGTGGATCACT
GCTCCAGAAGGCGACCGACCAGATCAGCCAGAAGGCTGACTCCGCGCTGGGCATCCGTGCGTCGGAACAG
GTCGAGCGCGAACTGGTCGACAGCCGTTTCGCTGCGCTGCGTGAGGTCGTGACCGGCAACGCAGAGGGTC
AGGCCACGGGCGACGCGGCCGCACAGCCCGGGAAAACCGGGCTGGACGGTGTGACCAACCTGCTGAACGA
CTACTACACTGCGCTCACGGTGGCGGATAACGCCATCAGCAACAACAGCATGCCGCCGGCGAGTGACACG
GCCGCGAAGCTGAAAATGACGGCGAACACCATGCCGCCTCCCTTCCGTGCCGTGCTGCTGCAACTCGCCC
AGCAGGGGTCGCAGGAGGTCAATCAGGGCATCGGTCAGCTGCTTTCACGTCAGATGGGTGCGGTGATCGG
CGATACGTGCCGCCTTACGATCGAGGGCAACTACCCGTTCACACCAGGTAGCACGCGCGACGTGAGCATT
GACGACTTTACGCGCGTGTTCGCGCAGGGCGGCGTCATTGACGACTTCTTCAACAAAACGCTGGCCCCCT
TCGTCGACACCTCCGCGAAACCGTGGCGCTACCGCACGTTGCCCGGTGCGACCGAGCCGGTCCAGGGGCC
GGACCTTGAGCCGTTCCAGCATGTGAAAGCGATCCGCGATGTCTTCTTCAGCGGCCCGGGCCAGAACCAG
ATGACGTGGAAAGCTAATCTCCAGGTGCCGGAGCTCGATCCCGCCATTACCGGCCTCATGATCGATATCG
ACGGACAGACGATGCTTTACCAGCACGGACCGGTCACGCCTTTCACGGTTAGCTGGCCCGGCCCTCGCGG
CGGCGTACACGCCGAGATCACGGCGAACCCGCGCATCCGGCCCGAGACGTCAACCATGTCTGCCGATGGC
CCATGGGCGTTGATGCGCCTGCTGGCCAAGGGGCACGTCGTGGAGACGGCCACACCCGGAAAGACACTCG
TCGCCTTCGATTTCGATGGGCGCCGCGCCGTGCTCGATATGGACAGTACCGGTAGCGTTGCCAACCCGCT
GACGAGCGACGTCCTGCGAACTTTCCGCTGCCCAAGCTCGATGCCGGTATTCGGTCTTGTCGACAGCGGA
CCGCCGCCGGGCCTGCCTGCTGCGGGGCTTCCCATGACGCCACCCAGCCCGTATTGA
 Primer design