SecReT6
Protein ID: 186896062
SecReT6 ID279
T6SS typei3
Gene symbol-
Locus tagYPTS_2757
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]3056858..3060685 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB2K8L9
KEGG IDypb:YPTS_2757
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.80E-84, Aligned region: 584..899
ImcF-related_N [PF14331], Evalue: 2.90E-72, Aligned region: 251..536
DUF1215 [PF06744], Evalue: 1.40E-29, Aligned region: 626..646
DUF1215 [PF06744], Evalue: 1.40E-29, Aligned region: 1014..1127
Protein Sequence: 1275 a.a.     [Download]
>gi|186896062|ref|YP_001873174.1| type VI secretion protein IcmF [Yersinia pseudotuberculosis PB1/+]
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPR
FVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHK
KAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISSRWRTELPWFMVVGMKGAGKTALILSSGQ
DFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWSGILKALKKYRPVKAINGVIV
AISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGV
TFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISD
VAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQAT
GAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFL
QKYLFPMVEHQSEVALRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKS
IFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHAT
QVFTLSDDELLHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEI
NIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADAPGGNNLSVLQGTQMSRIIGT
LNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDM
GVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAF
FEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIV
SLTAQRQKASAMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLL
RDFKCPSVNDMNGIW
 
Nucleotide Sequence: 3828 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c3060685-3056858 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGCATATTGCTGGTCGGCTGCTTTATAT
TGCTGGCTGCGGCGATATGGTTTCTGGGGCCTTTCCTCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTA
TGAAGCCAGAATTATTTGCATCCTGCTGGCACTGCTGCTGATCTTAGGTTTTTGGTACGGCGCACCGCGC
TTTGTCATTGCCGCCGTCGTTGCCTGTGCTGCGGTATGGGTGATTGGCCCATTCATATTAGTTGGTGATG
ATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTATCGCCATCATTGCATTTATTACACTTATTTA
TGGTACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCCAGCGTTACTGGATAACTTCATTAAGCACAAG
AAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAAGTTAATGCGATGATCCGCAATGGCATGAACT
ATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGACGTTTCTTTATCTCCAGCCGTTGGCGCACAGA
ACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGGGAAAACCGCCCTTATCCTCTCTTCAGGACAG
GACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGCAAAGAAAACCCACCCACTCAACATTGTGAATGTT
TGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAGGGAAATACATTGATGACAGCAAAGATAATCAGAC
TGAGTGGAGCGGGATATTAAAGGCACTCAAAAAATATCGTCCGGTTAAGGCAATTAATGGTGTCATTGTC
GCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCTGATTTACTGAATGTGTCGGCGACGCTACGCA
CGCGTTTGGATGAGGTACGTGCGGTCTTGGGCGTCCGTTTCCCGGTGTATGTCACGATTACAAAACTGGA
TCAATTATCGGGTTTTGATGAATATTTCCGTAATTTAACGGCTGAAGATCGCGAGCAAATTTGGGGGGTG
ACTTTCCCTTATAACGAGGCGAAAGAGCAATCAGATATGCCACTTCAGCAACGTATCAGCCATGAGCTGG
CACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAG
AAAAGGCATGTATGCACTCCCCCAGGATTTCAGGATGCTCTCCCAGAGGGTAACGGAAGTTTTACAGAAT
GTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTTCACACGACCCTGAGAGGGATCTATTTTGTCAGCA
GTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACAACACGCTGATTCAAAAGTGGCGTAACGTTATTAA
TCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAAAAGTGATAATGAAGATCGGTTTATCAGCGAT
GTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTTAGCGATGTGATTACCAAAGATGCCGACTTAG
TCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTCAGAATCTATTGGGACACGCGGCTTGTATTGG
GTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAGCTTCCAGCATAACGAGGGGTATTTACAGGCGACC
GGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGTTATGCCAAAACGTCCAATGAGCAGATCTTAC
CTGCGTTATTGAACGCGACACAGCAGTTACCCGAGTACGGTACGCTGGATGTGGCTAACCCTGAGCTTGA
CTGGCGTTATGGCTTATATACCGGTAGCGCAATCTCACAAGGTGCGAACACGCTCTATCAGTTTTTCTTG
CAAAAATATCTCTTCCCAATGGTTGAGCATCAGAGTGAGGTTGCATTAAGAAAAACGATGCACTCAGGTC
AGAGCGAAGAGGTTTATGCCGCGTTGAAGCTTTATTTGATGCTGACGGGTGAAGGTAAATTTGATCGTCA
ATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAGTGGAAAAATTGAGCCTTACGAAGAGAAGAGT
ATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAAGACTGGCGGCAGTACGGGCAACCGGCAGACA
GTGAACTGATTAAGCAGGCTCGGGCAATATTGGCGGAAAAAACAGTGACCGCCAGACTTTGGGGGCGTAT
TCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGACGTTACGTAAAATGGTGGGTGAGCACGCGACA
CAGGTATTCACCCTGTCAGATGATGAACTACTGCATGAAGGGATCCCAGGGCTTTATACCTACGCGGGTT
ACCATGAGGTGGTTAAAAAAAAACTGACACCTTTGCTGATGTTACTTCAAGAAGAGGATAGGTGGGTGAT
GGCGCAATCGCTGTCATCTTCTCTTGACCCATTGACGTTAAGACAAGATGTTCTGGTGATGTATTTACAA
GGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGTGTTCGTCTGATTTCTGTCGATGCGGACAGTGCAG
AGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGTTAAGGACGTTAGTTTCAGAAAATTCACCGCTACT
CAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACTCGCCGAAAAAGAAAAAGCCATTACTGATGAGATA
AACATCAGAACGCAAGGGCAATTACTCAGCCAGGCTAAAAAATTACAAGAAACGATCGCGTTTCGTGAAA
ATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTGAATCCCTGAGAGTCTTTGTTAATGGGGAACAGAG
TGCTGATGCCCCGGGGGGCAATAATCTTTCTGTTCTTCAGGGAACGCAGATGAGCCGAATAATCGGGACA
TTAAACGATCAATATACGCGTTTTGTTGTTTATAACAGTGCCTTTGAATATGGCGATATCCCTCCGTTAT
CCCAGGATGGGGAACGTATTGCGGTGGAATCACAAACGTGGCCGGATCCGTTTAGAAATATTATTGCACC
GTTATTAACGGGCTCATCTCAGAAATTTGAAAATAAAGTGATTACTCACACGTCCAAAGCGATTGATATG
GGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGGCGTTATCCATTTGCTGAAAGTGAGCAAATTGTTA
GTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACGGTACGGTGGACAGTTATTTCAAGAAAAACTTGGA
GAGTAAAGTCGACACCTCCTCAATACCTTGGCGTTATAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTC
TTTGAACAGGCGGCAATGATCAGAAACGTGCTATTTAATACCAATGACGGTAAAAAAATGGCATTAGATT
TTTCCGTATCAGTGCGTTATTTAGCACCCACTATCACCCAACTTATTATGAATTTTGATGGTAATACTGT
GCGTTATTCCCATGGTCCCGTAACGCCTGCCTTCTTTAAATGGCCGGGTTTACGTCAAGGCACCATTGTC
AGTTTAACGGCCCAACGCCAGAAGGCATCCGCGATGCCCGATATTCTTTTTCGCGGACCTTGGGCACTCT
TGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATGAAGCGAATGGCAAACAGACGCTGACTTATCTCAT
GGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTTAACGCATGGTGGTGAAACCATTAGCGATCTGCTG
AGAGATTTCAAATGCCCCAGTGTCAATGACATGAATGGTATTTGGTAA
 Primer design