SecReT6
Protein ID: 186897101
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3803
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4237235..4237468 [-]
Productputative rhs accessory genetic element
NoteTssI
UniProt IDB2K4V4
KEGG IDypb:YPTS_3803
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 0.00049, Aligned region: 2..60
Protein Sequence: 77 a.a.     [Download]
>gi|186897101|ref|YP_001874213.1| putative rhs accessory genetic element [Yersinia pseudotuberculosis PB1/+]
MVQLKDYTFKNPNWAVAFSEQSGELQNQRPDYEHFDFPGRFKDVQHGQDFTRYRLDALRKIIAEDQAWRY
HFQRLPS
 
Nucleotide Sequence: 234 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4237468-4237235 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGTGGCCTTCAGCGAACAGTCGGGAG
AACTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGTCCAGCACGG
GCAGGATTTTACCCGCTACCGGCTGGACGCGCTGCGCAAGATCATCGCGGAAGATCAGGCGTGGCGTTAC
CACTTCCAGCGGTTACCCAGTTAA
 Primer design

Protein ID: 186897105
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3807
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4242979..4245177 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2K4V8
KEGG IDypb:YPTS_3807
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.60E-70, Aligned region: 134..431
Phage_base_V [PF04717], Evalue: 1.40E-23, Aligned region: 471..563
Gp5_C [PF06715], Evalue: 1.20E-05, Aligned region: 605..628
Gp5_C [PF06715], Evalue: 1.20E-05, Aligned region: 630..654
Protein Sequence: 732 a.a.     [Download]
>gi|186897105|ref|YP_001874217.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis PB1/+]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEIAGGIGDAVGGTAGKRINQAAEVAKTALNA
KAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTAAGLPPQTFAVVDFTLSEMLSSPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKG
DRTVTVATGNETTDITQGSLTETIKVRRSTCANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDS
IILQFSGSTSITLNAANIDAIAPLINLNKDKG
 
Nucleotide Sequence: 2199 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4245177-4242979 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGTACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATAGCCGGGGGGATCGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGAATGCC
AAAGCAAAAGTCCTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGC
CGGACAGCGCCGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGGC
GGCCGGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCA
CGCTGTTTATCTGGCGCGAAGGGGTACTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
CGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAAGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGCTACCGGCTGGACGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGG
CAGTTGCTCGGCATTCAGCACAGCGGTAAACAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGACCGCCGGGGGAAGAGATTTACTGCGACGAATAC
GGGCGCATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGT
GGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACCGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAGGATGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCTCAAAAGGATATGAG
TACCACGGTAAAAGATAACCAGACGACGACGGTGGAGAAAGGTAATCAAACCGTCACCGTGGAAAAAGGT
GACAGGACAGTCACGGTCGCGACCGGAAATGAAACCACAGATATTACCCAAGGGAGCCTGACCGAGACGA
TCAAAGTGCGTCGCAGTACCTGCGCGAATTTTATTCAGGTGAAGGCTGAAGGTGATGCGCCTGGTACGCA
ACTTTATACCGCGACGGAACAGATAAAGTTCGTGGTGGGCAAGAGCAGCATTACCTTAAATCCGGACTCT
ATTATTCTGCAATTTTCTGGCTCTACCTCTATTACGCTGAATGCCGCCAATATTGACGCCATCGCGCCAT
TGATTAACTTAAATAAAGACAAGGGATAA
 Primer design