SecReT6
Protein ID: 186897103
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3805
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4237947..4242509 [-]
ProductYD repeat-containing protein
NotePAAR
UniProt IDB2K4V6
KEGG IDypb:YPTS_3805
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 451..466
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 543..564
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 585..610
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 624..649
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 636..664
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 657..694
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 711..735
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 744..781
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 788..824
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 815..846
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 852..886
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 916..935
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 942..966
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 978..992
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 1001..1013
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 1074..1094
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 1140..1160
RHS_repeat [PF05593], Evalue: 7.80E-46, Aligned region: 1177..1205
PAAR_motif [PF05488], Evalue: 6.90E-16, Aligned region: 193..261
RHS [PF03527], Evalue: 2.90E-07, Aligned region: 718..735
RHS [PF03527], Evalue: 2.90E-07, Aligned region: 1193..1203
RHS [PF03527], Evalue: 2.90E-07, Aligned region: 1283..1315
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 444..477
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 465..546
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 583..617
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 625..726
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 826..863
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 937..949
DUF4595 [PF15283], Evalue: 9.70E-05, Aligned region: 1147..1182
Protein Sequence: 1520 a.a.     [Download]
>gi|186897103|ref|YP_001874215.1| YD repeat-containing protein [Yersinia pseudotuberculosis PB1/+]
MTVAQSIGTGYGAAGAQSALRQTALGQQSPERTDYQVSNPNVGNIARASDSLLNVAESQQFNTLVTAGFG
MQAIAAGVAVPFTVGLAAGMAGGYVGAKIGNKLGHGIARALNFNQVATEGESPAHLGHPIAHQKKDWGVW
GAIGGILLGAAAAALVVVTFGTGLVVIAAAAAAAGLIGGIAAATGAALGQYGDNKGVIAEGSANVFFEGQ
PVARVGDKIQCSDHPSSPPPMIAEGAKTVFANQKQIARLGHRTTCDGNINAGCGSLAITQETAYVYEVAD
SRNPYLRWSAVILSFLPIQKKFEQGFRSLKKPPNTAVNATHNCPTGSDPVDMVSGDYLQVWPVIDIAGVL
PVRLQRTYRSGDYFTVSGCFGHKWADSWSQHLVVHEDNIDYIDEEGGGLSFFTPENKVQAVNLYNLRYEL
VGERHGELRVFDRSTQQTLHFNQQQQQQRYLSAITDRKGNRIDFRYQQGELISVEHSDGYVLEIDSRGRT
IHAVELVTQEKRQKLLQSTFSERGYLVQCQSFQYGTLSHEYDPKGYMVRWRDTDSTDVAVRYDISGRVVA
LKTSTGFFADHFIYHDKERYTIYRDGEGGETGYHYNENNLLIKLVDPLGNITLTDWDLTQKIKETDALGR
ITRFIYNERGDLTAVIHPDETRTEYEYNPSGVVTAFTSSAGDSWQYQYDRQGLLRQVTYPSGQTMSFRYG
KKGEVLRKIIAEDQVWRYHYDHHGCLSTIIDPKGNSTAVTLDVLGRLFSHQNALGELTRYTHSDAHASPA
GSVTKMVMPDGVEQAIAYDSEKRIAGLTDGAGKTTRYEYGGFDLLTGLIRPDGQRLTFGYDTLTRLNQVT
NASGDTYRYTRDRAGQVISETDFTGRTVHYQYDAVGRRIGARYPDQRLVRWHYSMQDQVLAQQTWHCDAL
SSTLVGTVSYGYDRAGRLLSATNADAVVEFDYDEAGQLVAERLNGREVRHQWDALNGTPVARQVGELGLT
FVYGAQGELTRLQLAGHQPLALQHDRLGRETVRESAAGFIQACNYTPSGLLAHQAAGRNSALFQQQLIAP
ESPALHGSAVNRSWQYDRAYNVVGMDDGRWGKTQYQYDRNDQVVRADFGGFLPLQEQFSYDVNQNLREHR
CLPRGAQAVLAQASQQQQAGRVVKRGDSQYRYDAGGRLVEKRSQKDGYRPQLWRYRWNEQDQLSELITPT
GARWRYGYDAFGRRIRKLRVVDTPPLNEMDAPSTGPATASLAGYAYLWSGDQLIEEVPVYADGTVAYEQG
IHWLYAPGGLTPMARYAQGKLHYVVADHLGTPRELLNEQGKVVWASRLSTWGQAELWRQAANEEDRVSCN
LRFAGQYADAESGLHYNRFRYYDGETGQYLCPDPIGLEGGLNPYGYVHNPVSWVDPLGLATCPPHPYQGV
RDASEYLRSQNVPRDFRKQIIQSFDIETIKVRPATSNEYGLRYFDNVNALEKGRYIFETFPATRSSLAVK
TEWNQMTYFSQFKVTPGVTIIEGKAAAQGVGLPGGQIQKYISNLDKLTKQ
 
Nucleotide Sequence: 4563 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4242509-4237947 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGACTGTCGCACAAAGTATTGGCACCGGGTATGGCGCGGCTGGCGCGCAATCGGCATTACGTCAAACCG
CGCTGGGGCAACAGAGCCCGGAGCGGACGGATTATCAGGTCAGTAATCCCAATGTGGGGAATATCGCGCG
AGCGAGTGATTCTCTGCTGAATGTGGCGGAAAGTCAGCAGTTTAACACTCTGGTGACCGCCGGTTTTGGG
ATGCAGGCGATTGCCGCCGGGGTGGCCGTTCCCTTTACCGTCGGGCTGGCCGCCGGGATGGCCGGGGGAT
ATGTCGGTGCCAAAATCGGCAATAAGTTAGGTCACGGTATTGCCCGTGCGCTTAATTTTAATCAAGTGGC
GACGGAAGGAGAAAGCCCCGCGCACCTGGGCCATCCCATTGCCCATCAGAAAAAAGATTGGGGGGTGTGG
GGGGCCATTGGCGGTATTTTACTGGGGGCAGCGGCGGCGGCATTGGTGGTCGTCACCTTTGGTACGGGGT
TGGTGGTGATTGCCGCGGCGGCGGCCGCAGCCGGATTAATCGGCGGTATCGCCGCCGCGACCGGGGCGGC
ATTAGGACAATACGGTGATAACAAAGGCGTGATTGCTGAAGGCTCCGCCAACGTCTTCTTTGAAGGCCAG
CCGGTGGCCCGGGTGGGGGATAAGATCCAATGCAGCGATCACCCCAGTTCACCGCCGCCGATGATTGCCG
AGGGCGCAAAAACCGTGTTTGCCAACCAAAAGCAGATCGCGCGTCTGGGGCACCGTACCACCTGCGATGG
CAATATCAATGCGGGATGCGGTTCGCTCGCCATCACGCAGGAAACGGCTTATGTGTATGAAGTGGCAGAC
AGCCGTAATCCGTATTTACGCTGGTCAGCGGTTATTCTGAGTTTCTTGCCAATACAGAAAAAATTTGAGC
AAGGGTTTCGCTCCTTAAAAAAGCCGCCGAATACCGCGGTCAACGCTACCCATAACTGCCCGACCGGCAG
TGATCCTGTTGATATGGTCTCCGGCGATTACCTTCAGGTCTGGCCCGTGATTGATATTGCCGGTGTTTTG
CCTGTCCGGTTACAGCGTACTTATCGTTCCGGCGATTATTTCACGGTCTCGGGTTGCTTTGGTCATAAAT
GGGCGGATAGCTGGTCACAACACTTGGTCGTGCACGAAGACAACATTGATTACATTGACGAGGAAGGGGG
GGGGCTGAGCTTCTTTACGCCAGAGAATAAAGTCCAGGCCGTCAATCTGTATAACCTGCGTTATGAGTTA
GTGGGGGAGCGTCATGGCGAACTCAGGGTTTTTGACCGGTCAACTCAGCAGACACTGCATTTTAATCAAC
AGCAACAGCAGCAGCGTTATTTATCGGCTATCACCGACCGCAAAGGGAACCGAATCGATTTTCGTTACCA
ACAGGGGGAACTGATATCGGTCGAGCACAGTGACGGCTATGTGCTGGAGATCGACAGCCGTGGCAGGACA
ATACACGCGGTCGAGCTTGTCACGCAGGAGAAAAGACAAAAGCTGTTGCAGAGTACATTCAGTGAGCGCG
GTTACCTCGTTCAGTGCCAGAGTTTCCAGTATGGCACGCTGTCGCATGAATATGATCCGAAGGGGTATAT
GGTGCGCTGGCGGGATACGGATAGCACGGATGTGGCTGTCCGTTATGATATTTCAGGGCGGGTGGTGGCA
CTAAAAACATCGACCGGTTTTTTTGCCGACCATTTTATTTATCATGACAAAGAACGCTATACGATCTATC
GCGATGGGGAAGGGGGAGAAACCGGTTATCACTATAATGAAAACAATCTGCTGATAAAGTTAGTCGATCC
GTTAGGCAATATCACCCTCACCGACTGGGACTTGACCCAGAAAATAAAAGAAACCGATGCATTAGGGCGT
ATCACCCGGTTTATTTACAATGAGCGCGGTGATTTAACCGCCGTGATCCACCCGGATGAAACCCGTACCG
AATATGAGTATAACCCGTCTGGCGTGGTCACTGCGTTTACGTCTTCGGCGGGGGATAGCTGGCAATATCA
GTATGACAGGCAGGGATTGTTACGACAGGTAACTTATCCTTCCGGCCAGACGATGTCGTTTCGCTACGGC
AAGAAGGGAGAAGTGCTGCGCAAGATCATCGCGGAAGATCAGGTGTGGCGTTACCACTATGATCACCACG
GTTGTTTAAGCACCATTATCGATCCGAAGGGGAACAGTACAGCCGTCACACTGGATGTGCTGGGGCGGTT
ATTTTCTCACCAAAACGCCCTCGGGGAGCTCACCCGTTACACACACAGTGACGCGCATGCCAGTCCGGCG
GGCAGCGTCACAAAAATGGTCATGCCGGATGGTGTGGAGCAGGCCATTGCCTATGACAGCGAGAAGCGTA
TTGCCGGGCTGACCGATGGCGCGGGGAAAACCACCCGTTACGAATACGGCGGTTTTGATTTACTGACCGG
CCTGATACGCCCGGACGGGCAGCGGCTGACCTTCGGCTATGACACACTGACGCGCCTGAATCAGGTGACC
AATGCGTCAGGTGACACCTATCGTTATACCCGTGATCGGGCCGGGCAGGTGATCAGCGAAACCGATTTTA
CCGGGCGCACGGTTCATTATCAGTATGATGCGGTGGGGCGGCGTATCGGGGCGCGTTACCCGGATCAGCG
CCTTGTTCGCTGGCACTACTCGATGCAGGATCAGGTGCTGGCGCAGCAGACCTGGCACTGTGATGCACTG
AGTTCCACGCTGGTTGGCACGGTCAGCTACGGTTATGACCGTGCCGGTCGTTTACTGAGCGCGACCAATG
CGGATGCGGTGGTGGAGTTTGATTACGACGAGGCGGGTCAGTTGGTTGCGGAGCGGCTGAATGGCCGGGA
GGTGCGGCATCAGTGGGATGCGCTAAACGGCACCCCTGTTGCCCGACAGGTGGGTGAGCTGGGGCTGACG
TTTGTGTACGGCGCACAGGGCGAACTGACCCGGCTACAGCTGGCGGGCCATCAGCCCCTGGCGTTGCAGC
ATGACCGATTGGGGCGAGAGACGGTACGTGAAAGCGCGGCCGGGTTTATTCAGGCCTGCAATTATACCCC
GAGCGGGCTGTTGGCCCATCAGGCGGCCGGGCGTAACTCGGCATTATTCCAGCAACAGTTGATCGCCCCG
GAGAGCCCGGCCTTGCACGGCAGTGCGGTCAACCGCAGTTGGCAGTATGACCGGGCTTATAACGTGGTGG
GGATGGATGACGGGCGTTGGGGTAAAACGCAGTACCAATATGACCGCAATGACCAGGTCGTCCGCGCTGA
TTTTGGTGGTTTTTTGCCGTTGCAGGAGCAGTTTAGCTACGATGTGAACCAGAACCTGCGCGAGCATCGC
TGTTTACCGCGTGGGGCACAGGCGGTTTTGGCGCAGGCGAGCCAGCAACAGCAGGCGGGCCGGGTGGTGA
AGCGCGGTGACAGTCAGTACCGTTACGATGCTGGCGGGCGACTGGTGGAGAAACGCAGCCAAAAAGACGG
CTACCGGCCACAGCTGTGGCGCTACCGCTGGAATGAGCAGGACCAGTTATCCGAATTGATCACGCCGACG
GGGGCGCGCTGGCGCTACGGTTATGATGCCTTTGGGCGACGTATTCGAAAACTGCGGGTAGTGGATACCC
CGCCGCTCAATGAGATGGACGCTCCTTCCACCGGTCCGGCCACGGCATCACTGGCCGGTTACGCGTACCT
GTGGAGCGGCGACCAGTTAATCGAAGAGGTGCCGGTGTATGCCGACGGCACGGTGGCGTATGAGCAGGGG
ATCCACTGGCTGTATGCGCCGGGCGGATTAACGCCGATGGCGCGCTACGCGCAAGGCAAACTGCATTATG
TGGTGGCGGATCATCTGGGTACGCCGCGGGAGTTGTTGAATGAGCAGGGCAAGGTGGTGTGGGCGAGCCG
ACTGAGCACGTGGGGGCAGGCGGAATTATGGCGACAGGCGGCGAATGAGGAGGATCGGGTCAGCTGTAAC
CTGCGTTTTGCGGGTCAGTACGCGGATGCAGAATCCGGGTTGCATTACAACCGGTTCCGCTACTATGATG
GCGAGACGGGGCAATATCTATGCCCGGACCCGATAGGGCTGGAAGGGGGATTAAACCCGTACGGGTATGT
ACATAATCCGGTGAGCTGGGTGGATCCGCTGGGGCTGGCAACATGTCCTCCTCATCCATATCAAGGTGTT
AGAGATGCATCAGAATATCTGAGATCACAAAATGTGCCTCGTGATTTTAGAAAGCAAATAATCCAGTCTT
TCGATATAGAAACAATCAAGGTACGCCCTGCAACATCGAATGAATATGGGCTAAGGTACTTTGATAATGT
TAATGCTTTGGAGAAAGGAAGATATATATTTGAAACATTTCCTGCAACCAGATCTAGTTTGGCGGTTAAA
ACCGAATGGAACCAAATGACTTATTTTTCACAATTTAAAGTCACTCCAGGTGTTACCATCATTGAAGGAA
AGGCTGCTGCTCAAGGTGTTGGCTTACCTGGCGGTCAGATACAAAAATACATTAGTAACTTGGATAAGTT
AACAAAACAATGA
 Primer design