SecReT6
Protein ID: 186897106
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3808
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4245199..4246512 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB2K4V9
KEGG IDypb:YPTS_3808
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.50E-48, Aligned region: 90..154
DUF3702 [PF12486], Evalue: 1.50E-48, Aligned region: 284..431
ImpA-rel_N [PF06812], Evalue: 5.80E-22, Aligned region: 41..101
Protein Sequence: 437 a.a.     [Download]
>gi|186897106|ref|YP_001874218.1| ImpA domain-containing protein [Yersinia pseudotuberculosis PB1/+]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVQTAAAA
PEPAANIEVRSPPPATKRGAVLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPD
VATYGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPGQVAESQRWARLVEARIGLAGTDSSYFQLQQR
LHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWN
ALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4246512-4245199 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAGTC
ACTGGCGCTGACCCTGTTCCGCACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTGGTCGGCCAGT
GGGATCACCTGTGGCCGGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTGCGGCTGGTGTACCGCGCCGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAACGGGTACCGCGCATTGAAAACTTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGATGCGGCGAAGGCTCAGCAAACCGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCAGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCCAGCGACCAAACGGGGGGCGGTGCTGTGGG
GCTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCT
GCAACAGCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAACCGCCCGGAT
GTCGCCACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTCAATACCGCCG
ACCAGTCGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCGGTCAGGTGGCCGAAAGCCAGCGCTG
GGCGCGGTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCTCCAGCAGCGC
TTGCATGCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACCATCTCCTATCTAA
AAACAGCAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTACTGCGCCAGTT
GGCGGTGTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGACCGCTGGAAT
GCCTTACTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA
 Primer design