SecReT6
Protein ID: 186897107
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3809
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4246637..4250170 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB2K4W0
KEGG IDypb:YPTS_3809
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.00E-89, Aligned region: 507..822
ImcF-related_N [PF14331], Evalue: 1.40E-69, Aligned region: 201..455
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 309..323
DUF1215 [PF06744], Evalue: 4.80E-39, Aligned region: 916..1035
DUF4131 [PF13567], Evalue: 0.00069, Aligned region: 15..93
DUF4131 [PF13567], Evalue: 0.00069, Aligned region: 444..477
MMR_HSR1 [PF01926], Evalue: 0.0036, Aligned region: 133..273
Protein Sequence: 1177 a.a.     [Download]
>gi|186897107|ref|YP_001874219.1| type VI secretion protein IcmF [Yersinia pseudotuberculosis PB1/+]
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLVTAVFVLVAVC
WLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHLNTPEYLYRLPWYMVIGARNS
GKSTLIKEGYKLTEISASERLHVEGAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSL
LSWLIEQRQRQPLNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGF
EAMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTR
QMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYYHQLNYRAGEEVLTQAKT
FLSIPPPEGDDRYGNLQLPLLNPIRDATLAYGNYHERSPFLADMGLYQGNNIGPYVESTYLQLLQQRFVP
ALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYA
LKHTDWHGARESGDQYAIKSFVPYLRPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRDQIGASF
DDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEYSEADRKEIHRQVTEQYL
GDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRALQTLSDNTRLPVISDLIPAKEQQELLQK
PDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRYLLAIQNSPAPGKAALKAVQLRLDQNNS
DPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVEWNETVIKQYQTYLAGRYPFDPHAKQDV
PLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGTQF
AIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESGKSPRTLSFSGPWA
QLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGLFSKFSLPDTLY
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4250170-4246637 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAAATTGCCGTTCTTTATACGCATAGCCAAGCCCGCCATTCCTCGCCTTAAAGCGTCAATACCGGTGG
TATTGGCGTTGATGGCTTGTGCGGCACTCATTTGGGTATGGATTTACGGACCCGAGTGGCAATTGGGGGA
AAATTACCCGTTTGAGACATTATTGAGCCGTTGGTTGGTCACGGCGGTATTTGTCTTGGTGGCCGTTTGT
TGGCTCAGCCTGAAAGTCATGAGGCGAGTACAACACCTGGAAAAACTCCAACTGCAAACGAAAATTCAGC
TCGATGACCCCGTCAGTGCTGATATCGAACAACAAAACCACTACCTCAATGGCTGGAAGCACCAACTTCA
GCGCCATTTGAACACCCCAGAATATCTGTATCGCCTGCCCTGGTACATGGTCATTGGTGCGCGCAATAGC
GGCAAAAGTACACTGATCAAAGAAGGGTATAAACTGACAGAGATCTCCGCATCCGAGCGGCTCCATGTGG
AAGGCGCAGCAGATCTGCGCGTCCGCTGCTGGTTGGGGGAACAAGCGGTTATTATCGATCCTGCGGGGGT
GCTGATTGAACAACCTACGACACCGATCGCGGGCAAAGCATCACTCAACAGCCGCTTATGGCAAAGTCTA
TTATCCTGGCTGATTGAACAGCGCCAGCGTCAGCCGCTAAACGGCATTATTCTCACCGTCGATCTTCATC
AGATGATGACCGCGAATAAAGCGCAGCGGGAGACGTACGTCGCTGATATTCATCAACGGCTGCAAGAGAT
ACGGCTGTCTTTGCACAGCCAGGTGCCGCTGTATGTGGTGTTCACCAAAATGGACCTGCTGTACGGCTTC
GAGGCCATGTACCAATCGCTGGATAAAGCCGAACGTGAAGCGGTTCTGGGGGTGACGTTCAGCCTCAATG
CGGCGGATCCGGACGTGTGGCGGACGGAGTTGAAACAGTTCTGGCAGCAATGGGTCGCACAACTGAATGG
CGCGATGCCGGACATGATGCTGAACAGTGTGGATGCCGGGCAGCGTAGCCAGTTGTTTAGCTTCACTCGC
CAGATGCAGGGCCTGCACGATTACGTCGTGCAACTGCTGGAAGGCATTCTGTACCGTGGAGAACATGCCC
AGCCGCTGTTACGGGGGGTTTATCTCACGTCTGCCCAGCAACGTGGGCAAATGGACGATATCTTTACTCA
ATCTGCCGCGGTGCAATATCACCTTGCACCACAGGCCTTCCCGACCTGGCCGGTCTCGGATACGACGCCG
TATTTTACCAAAGCGCTGTTTAACCAGGTGCTGTTGGCCGAACCCAATCTGGCCGGAGAGAACGGTATCT
GGCTACAAAAAACGAGAAAGCGAATGTTCATTTTCTCGGGGGTGGGTGCCCTGGCCGCGCTGACCTTATG
GGGCTACTGGCACTACTATCACCAGCTTAACTACCGGGCTGGCGAAGAGGTATTAACCCAGGCAAAAACC
TTCTTATCGATCCCACCGCCAGAAGGCGATGACCGTTATGGCAATCTGCAACTGCCGCTGCTAAACCCCA
TCCGTGACGCCACGCTGGCTTACGGTAATTACCATGAACGCAGCCCGTTCCTGGCGGATATGGGGTTATA
TCAGGGCAATAATATCGGGCCTTATGTCGAAAGCACTTACTTGCAACTCCTACAGCAACGTTTTGTCCCG
GCACTGATGAGCGGGCTGTTGGAACAACTGAACGCCGCACCGAAGGGCAGTGAAGAGAAACTGGAAATTC
TGCGGGTGATGCGGATGTTGGAAGACGGCAGTGGCCGCAATGCCGCGCTGGTTGAACAATATATGAGCCA
CCGCTGGAGCCAACAATTCAACGGCCAGCGCGAGTTGCAGGAGCAACTGTCGAGCCACCTGAACTACGCA
CTGAAACACACCGACTGGCACGGCGCACGGGAAAGTGGCGATCAATATGCGATCAAGAGCTTTGTCCCGT
ACCTCCGCCCGATCCAGTCAGCGCAGCAAGAGTTGAGTAAACTCTCGATCTACCAACGGGTGTATCAGAA
CCTGCGGATCAAAGCACAGGATGCGTTGCCGCCCGCGCTCGATTTGCGCGATCAGATCGGCGCAAGTTTT
GACGACATTTTTGTCTCCGGTAACGATCGCCTGCTGGTGATCCCGCAATTCCTGACCCGTAGCGGCTTAC
AGAGTTACTTCATCAAACAGAACGATCAACTGGTTGATCTCACGGTGATGGACAGTTGGGTACTTAATCT
CACCAAGAACGTCGAATACAGCGAGGCAGACCGCAAAGAGATCCATCGCCAGGTGACCGAACAGTATCTT
GGCGACTATACCGCCACCTGGCGTGCGGCCATGAATAACCTATCGGTCAGTGATTTTGAAGGCTTGCCAC
AGGCGATCAGCGCCATTGAACAGGTGATCAGCGGGGAACAACCTTTCCGCCGTGCACTGCAAACGCTGAG
TGACAACACCCGCTTGCCGGTTATCTCGGATCTGATCCCCGCGAAGGAGCAGCAAGAGCTGCTGCAAAAA
CCCGATTACCTGCTGCTGACCCGCATCAACCGTGAGTTCTCCCCCGAAACGGCGGTGCTGGTGGAGAATG
GCGATAAAGGCAGCGTGATCCAAAGTGTTTACCAAAAACTGACCGAGCTACACCGCTATCTGTTGGCGAT
CCAAAACTCGCCCGCGCCGGGCAAAGCGGCGTTGAAGGCGGTGCAATTACGTCTGGATCAAAACAACAGT
GATCCGATTTTCGAAGTCCAGCAACTGGCTAAAAACCTGCCGGAGCCGCTAAACCGCTGGGTGGGCGAAC
TGGCAGAGCAAGCCTGGCGGGTGGTGATGATGGAGGCGATCCAGTCACTGGAAGTGGAGTGGAATGAGAC
GGTGATCAAACAGTATCAAACCTACCTGGCCGGACGTTATCCCTTCGATCCTCACGCGAAACAGGATGTA
CCACTCAGTGAGTTTGAACGCTTCTTCGGGCCGAAAGGCACGCTCGATGCATTCTATCAGCAGAACCTGA
AACCGTTTGTCGAAAACAACCTGACCGGTGGCAGCGATGGCGAATTGCTGATCCGGCCTGATGTGTTACA
GCAACTGGCGCAGGCGCGGAAAATTCGCGACACCTTCTTCTCGGCCCAAAACGGCCTGGGCACACAGTTT
GCGATTGAACCGGTGCTGTTAAGTGGCAACAAGCGCCGCAGCGTATTGAATCTGGATGGGCAATTACTGG
ATTACGCCCATGGCCGCAGCGGCGTAGTGCATCTGGTTTGGCCAAACTCGATGCGTGCAGGAGTGGAAAG
CAAACTGACGTTAGTCCCGGATGAGAGCGGCAAATCACCGCGCACCCTCAGCTTCAGCGGTCCTTGGGCG
CAGTTGCGGCTGATCAACGCCGGTGAACTGACCAATGTGGGCACCAACTCCTTCGATGTCCGCTTCAAGG
TTGATGGCGGCGAGATGACGTACCGCATCTTTGTTGATGAATCCGACAACCCATTCGCGGGCGGTTTGTT
CAGTAAATTCAGTCTGCCAGACACTCTGTATTGA
 Primer design