SecReT6
Protein ID: 186897116
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3818
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4259790..4260878 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB2K4W9
KEGG IDypb:YPTS_3818
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-93, Aligned region: 38..348
Protein Sequence: 362 a.a.     [Download]
>gi|186897116|ref|YP_001874228.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEA
IRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFN
HRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEV
ICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLL
CINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDP
EQKPSVTIGVME
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4260878-4259790 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGGTTGAGAATG
TAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTTTCAATTGGT
CGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCCAATGAAGCC
ATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACACCTCCGCCC
GAGGTCAATTTGAGCTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACCAGGATATTA
CCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGTTGACGGATTTCATGAACGTATTCAAT
CACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTGACAATGGCG
GTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCGCAATAAATT
GCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCACCTGAAGTA
ATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGCTACGCAAGG
TGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAAATATGATGA
AAAGTCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAATTCTTGTTG
TGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACGCCTCGTTAG
TGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGCCGAGCAACA
GGTGGGCGGGATGGTTCTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTCGGCGATCCC
GAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA
 Primer design