SecReT6
Protein ID: 186897117
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3819
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4260842..4262662 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB2K4X0
KEGG IDypb:YPTS_3819
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-200, Aligned region: 3..606
Protein Sequence: 606 a.a.     [Download]
>gi|186897117|ref|YP_001874229.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSVHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPDVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGAPKGRGRGHGRVYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAE
ENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLL
DKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGEL
YLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4262662-4260842 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTGTTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAATTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACGCAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAGTATTTTTGCTTCCCCGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCGGACGTGAAAGTCCGCTCCACCACACTGCGAATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGCTCCTAAGGGGCGCGGCCGGGGTCATGGCAGGGTGTACACCTCGTTTGAGAGCT
TCCACCATCAGATCGAACACTCGCAAGAAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATT
ATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAA
GAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCA
ATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTA
TCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTG
GATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCTGCCA
GGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGG
CTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGGGCCTTTAGCTCTGAAGGCGAGCTT
TATCTCTTTAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAA
AAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTA
A
 Primer design