SecReT6
Protein ID: 186897118
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3820
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4262662..4263102 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB2K4X1
KEGG IDypb:YPTS_3820
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-19, Aligned region: 32..122
Protein Sequence: 146 a.a.     [Download]
>gi|186897118|ref|YP_001874230.1| type VI secretion system lysozyme-like protein [Yersinia pseudotuberculosis PB1/+]
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATA
TSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRY
CFNQET
 
Nucleotide Sequence: 441 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4263102-4262662 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGGCCGCGCTTCTTAATTGGGATCGAGGGAGTTCTGCCAGTTTGTTTGACCGCATACAGGGGAAGGGCG
CTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATTCAATCCAAAAGCATTTGAACGAGGTCCT
TAACTCTCGTCCAGGTGCTTGTCAAAGTGCGGTCGATCTCGGGGTTATCGACCTCAATGATGCGACCGCC
ACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAGGATTGTATCGAGAACTACGAACCCCGAA
TTTCTGCCGTTACGGTTCAATCCTTGCTGAACCATGGCGACCCACTGCAACTGAGTTTCCATATTAGCGC
TCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAACATTCAGTTAGACAATAACCGCCGTTAC
TGCTTTAACCAGGAAACATAA
 Primer design