SecReT6
Protein ID: 186897120
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3822
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4264658..4265155 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB2K4X3
KEGG IDypb:YPTS_3822
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.30E-57, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|186897120|ref|YP_001874232.1| type VI secretion protein [Yersinia pseudotuberculosis PB1/+]
MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGVREDTSIEERQVVSVNKNNFNSVMNE
ANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFSPDNVAKKVPELKKILELREALVALKGPLGNIPAFRS
RLQDLLGNEDMREQLLKELDILNQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|186893344|ref|NC_010634.1|:c4265155-4264658 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGAGTAAAAATAAGCAAAGCAGTGTTGCCCCAAAAGAAAGGATTAACATCAAGTATGTGCCGAATACTG
GCGACCAGGTTGCAGAAATTGAATTACCGCTGAATCTGCTGGTTGTGGGTGATCTTAAAGGCGTGCGTGA
AGATACATCAATTGAAGAGCGTCAGGTTGTTTCGGTCAATAAGAATAACTTCAACTCAGTCATGAACGAA
GCAAATATCAGTCTGAGTTTCAATGTGCCTAATCGCCTTGAAGGTGATGGGGAAGAAGACATGCCGGTCG
CCTTGTCGATCAAGGGTCTCGATGATTTCTCGCCTGACAATGTGGCGAAAAAAGTTCCAGAGCTCAAAAA
AATTCTGGAACTACGGGAAGCGCTAGTGGCATTGAAAGGGCCATTGGGGAATATCCCGGCTTTCCGCTCT
CGTCTACAGGATTTGCTTGGCAATGAAGATATGCGCGAGCAGTTGCTGAAAGAATTGGACATTCTTAATC
AAAAATAA
 Primer design