SecReT6
Protein ID: 186897121
SecReT6 ID281
T6SS typei1
Gene symbol-
Locus tagYPTS_3823
StrainYersinia pseudotuberculosis PB1/+
Repliconchromosome [GenBank: NC_010634] [Browse all T6SS(s) in this replicon]
Location [Strand]4265679..4266197 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDB2K4X4
KEGG IDypb:YPTS_3823
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|186897121|ref|YP_001874233.1| Hcp1 family type VI secretion system effector [Yersinia pseudotuberculosis PB1/+]
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPSGQRAHKPLRF
TVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATIIDIDCRMPHCQDSTKAEFTQ
LVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|186893344|ref|NC_010634.1|:4265679-4266197 Yersinia pseudotuberculosis PB1/+ chromosome, complete genome
ATGCCAACTCCAGCTTATATCTCTATCACAGGGAAAACGCAGGGCAATATTACCGCAGGTGCTTTCACTG
CTGAATCCGTCGGTAATATCTATGTTCAAGGTCATGAAGACGAAATGTTGGTACAGGAGTTTGAGCACAT
TGTGACGGTGCCTACCGACCCTCAATCCGGCCAGCCTTCCGGCCAACGTGCGCACAAACCATTGCGTTTC
ACTGTTGCGTACAACAAAGCCGTTCCATTGCTGTATAACGCATTAGCCTCTGGTGAAATGCTGCCAACAG
TGGAATTGAAGTGGTACCGCACCTCGATTGAAGGCAAACAAGAGCATTTCTTCACGACTAAACTGGAAGA
TGCCACCATTATCGACATCGATTGTAGAATGCCGCATTGCCAGGATTCCACCAAGGCTGAGTTTACTCAA
TTAGTCCGTGTATCACTGGCATACCGCAAGATTAACTGGGATCACACCACCGCGGGCACCTCTGGTGCTG
ATGACTGGCGTGCGCCGATCGAAGCGTAA
 Primer design