SecReT6
Protein ID: 187476796
SecReT6 ID282
T6SS typei4a
Gene symbol-
Locus tagBAV0282
StrainBordetella avium 197N
Repliconchromosome [GenBank: NC_010645] [Browse all T6SS(s) in this replicon]
Location [Strand]290714..294478 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ2L027
KEGG IDbav:BAV0282
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-33, Aligned region: 129..363
ImcF-related_N [PF14331], Evalue: 1.10E-33, Aligned region: 847..876
Protein Sequence: 1254 a.a.     [Download]
>gi|187476796|ref|YP_784820.1| unnamed protein product [Bordetella avium 197N]
MLLSNNLFLVSVLVLLIVAILGVAVVLYFATRPVGEKPKPEVVPTWSADALRAGFRQAIDIIESNISSRA
ERYNVPWVVVLEDGDQARLPLGHTGIPGVYGSGPALSQQIHWEFFERGVVVDLAVGATQESDRDEQWEQF
LTLCRSYRPQRPFDSVVVTIPAALLLDSEARPELIRRAGVMHRRLWLAQNRFAMRLALYVLVTECESMTG
FSAFARALPDGMRASMLGWSSPYDPSISYQSDWVEQAMADVAATVDDTVAEVLVTREVGVADMLVLTSRV
REIQPQLQLYLDELMRPNVYHEPFLLRGVYLTGDSGELQAPQSANAPDLLQPAFLRAVFERKIFLESGLT
RPIRNATLTRPLLHKGLRFAAGGVLGVWAIGIVVATIDVGRHAPGQVAALREIRRIAAADDQDRSADWYQ
RSAITLLGLEPEVRGEGGLAWMLPGSWSMFDGLNAALREALMREFRDVVRVAIERGFAARATALSGQTGP
DGPCRAPAGLAEGADVLALTDRADFRAMLAYVSQVERFSNAWSAWHDRTAGVLSLQPAVQYALGIDASPS
ALQILASMPPPEAHQNVYADAFRCAYEKGMGQLEDSLFTQNPLLRAERKAQHALAAFTQRAPVDGEADLR
DLVHAISAEQDLLSSANTAWLHQDVFMPDPLLEQIFSTAAKVPLLGQTVVAKSRASFQDAFAVLRSQIAS
FTSGSDAGLQWRENQYVLSPGRLALRDSLAGLLVQPFMQVPPATQVPDLRGAALVHWDISALDQALVLMD
ARTAFLARGLAGVPLTYVPAVMQSANAQAGLGLYRRAVAALEPGFALRSMEFQAAADRVRRIASLLGDLG
AVRERGELLALLSRGALAALTHLDDMLRRADLYAVQTDVSLPGTSLLAAFGVADLAGLDAYLAQQAGTLQ
ELSAQAAVYLTALSPSDARSVVAQRWQMIGQELERYALRNPNSALLRLEQWIRLAGQTKDCAKWPAAPSA
SSGYFELHWSRLAATLRERCLGRDSLQFQTDWRRFTTAYNELLGGRMPVADPKAPSRGVVPRPAATVQGV
QDVLGRFQSLPSYEWPPGAIADFLTRFRAWAEVLQPLWSATGESGYHLAWNFRVNRGAEVAANQIISWTL
SVGSESVGSDMPDARLRWAVGLPITLSVRLAKDAPLLPRADPTQPRMSVDGHQVSWTFHGPWALFTMLGW
QGLDSGLLRFEVPVMVENINDFARLPPGQKLKFFVDLNLFSLGEGKPLNWARPLPLIAPAGSGP
 
Nucleotide Sequence: 3765 bp     [Download]
>gi|187476514|ref|NC_010645.1|:290714-294478 Bordetella avium 197N chromosome, complete genome
ATGCTACTGAGCAACAACCTCTTTCTCGTCTCGGTATTGGTGCTGTTGATCGTGGCCATTCTCGGGGTCG
CGGTGGTGCTTTACTTCGCCACGCGTCCGGTGGGCGAAAAGCCCAAGCCTGAGGTGGTGCCCACTTGGTC
GGCCGACGCCTTGCGTGCCGGTTTTCGGCAGGCTATCGATATCATCGAGTCCAATATCAGTTCGCGCGCC
GAACGCTATAACGTGCCCTGGGTCGTGGTGCTCGAGGATGGCGATCAGGCGCGTCTTCCCCTGGGGCATA
CCGGCATTCCGGGGGTCTATGGCAGTGGCCCCGCCTTGTCACAACAAATTCATTGGGAGTTCTTCGAGCG
GGGCGTGGTGGTTGATCTCGCGGTCGGGGCGACGCAAGAAAGTGACAGGGACGAGCAGTGGGAGCAGTTC
CTGACGCTGTGCCGCAGTTACCGGCCGCAGCGGCCATTTGATAGCGTTGTCGTGACGATTCCTGCGGCCC
TGCTGCTGGATAGCGAAGCGCGCCCCGAGCTGATACGCCGTGCCGGTGTGATGCATAGACGTCTGTGGCT
GGCTCAGAACCGCTTCGCCATGCGCCTGGCTCTGTATGTTCTGGTGACAGAGTGCGAGAGCATGACGGGC
TTCAGCGCCTTTGCGCGTGCCCTGCCAGATGGTATGCGGGCCAGCATGTTGGGCTGGTCATCGCCTTACG
ATCCATCGATTTCTTATCAGTCCGACTGGGTAGAGCAGGCGATGGCGGACGTTGCCGCTACGGTTGACGA
TACCGTGGCCGAGGTTCTGGTCACGCGCGAGGTGGGCGTCGCCGACATGCTGGTCTTGACCTCGCGCGTA
CGTGAAATTCAACCCCAACTCCAGTTGTATCTGGATGAGTTGATGCGGCCCAATGTTTATCACGAACCGT
TTTTGTTGCGGGGCGTTTACCTGACCGGAGACAGTGGCGAACTTCAGGCGCCTCAGTCGGCCAATGCGCC
GGACTTGCTGCAGCCGGCCTTTCTTCGTGCGGTGTTCGAGCGCAAGATTTTTCTGGAATCCGGCCTGACA
CGCCCGATCCGCAATGCCACGCTGACGCGCCCGCTCTTGCACAAAGGCTTGCGCTTTGCCGCCGGGGGCG
TGCTGGGCGTATGGGCCATAGGTATCGTGGTCGCCACCATCGATGTCGGCCGCCATGCGCCAGGACAGGT
GGCTGCCCTGCGAGAGATACGGCGCATTGCGGCAGCAGATGATCAGGATCGTTCGGCAGACTGGTATCAA
CGCAGTGCAATCACGCTGCTGGGGCTGGAGCCGGAGGTTCGCGGCGAAGGTGGTTTGGCCTGGATGCTGC
CGGGTTCCTGGTCGATGTTTGATGGTCTGAATGCCGCGCTGCGTGAGGCGCTGATGCGCGAATTCCGCGA
CGTGGTGCGGGTGGCGATTGAGCGTGGCTTTGCGGCACGCGCCACGGCCTTGAGCGGCCAGACGGGGCCG
GACGGTCCATGCCGTGCGCCGGCGGGCCTTGCTGAGGGGGCTGATGTGCTGGCGCTGACCGACCGCGCCG
ATTTTCGTGCAATGTTGGCCTATGTTTCCCAAGTTGAGCGGTTTTCGAATGCCTGGAGCGCCTGGCACGA
CAGGACTGCGGGAGTGCTGTCTTTGCAGCCGGCGGTTCAGTATGCATTGGGGATAGACGCCTCACCCTCT
GCCTTGCAGATCCTGGCCTCCATGCCGCCGCCTGAGGCGCATCAGAATGTCTATGCAGACGCCTTCCGGT
GCGCTTACGAAAAAGGCATGGGGCAGCTCGAAGACTCGCTGTTCACGCAAAACCCTCTGTTGCGCGCCGA
GCGCAAGGCGCAGCATGCCCTAGCCGCTTTTACGCAGCGGGCGCCCGTCGACGGAGAGGCCGATTTACGC
GATCTGGTGCATGCCATTTCCGCGGAACAAGACCTGCTCTCTTCGGCCAACACCGCTTGGCTGCACCAGG
ATGTTTTCATGCCTGATCCCCTTCTTGAGCAGATTTTCTCCACCGCTGCCAAGGTGCCGCTGTTGGGACA
GACGGTCGTGGCGAAAAGCCGAGCGTCCTTTCAGGACGCCTTCGCGGTGCTGCGCAGTCAGATTGCGTCA
TTTACCTCTGGTTCCGATGCGGGTTTGCAATGGCGCGAAAACCAGTATGTCTTGTCGCCAGGCAGATTAG
CTTTGCGTGACAGTCTGGCGGGATTGCTGGTGCAACCCTTTATGCAAGTGCCGCCCGCAACGCAAGTCCC
TGATCTGCGTGGGGCGGCGCTGGTGCATTGGGATATCAGCGCGCTGGATCAGGCCCTGGTGTTGATGGAT
GCGCGCACGGCCTTCTTGGCTCGGGGGCTGGCAGGCGTGCCGCTTACCTATGTGCCGGCCGTCATGCAAA
GCGCGAATGCGCAGGCGGGTCTGGGTCTGTATCGGCGGGCGGTGGCTGCCCTTGAGCCAGGCTTCGCTTT
ACGGTCGATGGAGTTTCAGGCGGCGGCCGACCGTGTGCGGCGGATTGCCTCCCTGCTCGGTGACCTGGGT
GCGGTGCGGGAGCGTGGCGAGTTGCTGGCATTGCTCTCGCGCGGGGCGCTGGCGGCGCTGACGCATCTGG
ATGACATGTTGCGCCGCGCAGATCTTTATGCCGTCCAAACTGATGTGTCGCTGCCTGGCACATCCTTGCT
GGCAGCCTTTGGTGTTGCAGACCTGGCGGGGCTGGATGCCTATCTGGCGCAGCAGGCGGGCACGTTGCAG
GAGTTGTCGGCCCAAGCCGCCGTTTATCTGACGGCACTTTCTCCGAGTGATGCCCGCTCTGTTGTGGCGC
AGCGATGGCAAATGATAGGGCAGGAACTTGAACGTTATGCCTTGCGCAATCCTAATAGCGCCCTGCTGCG
GCTTGAGCAATGGATACGCCTGGCCGGGCAGACCAAGGACTGCGCCAAGTGGCCTGCGGCGCCGAGCGCT
TCGTCGGGTTACTTCGAACTGCATTGGTCTCGTCTGGCCGCGACCCTGCGGGAGCGTTGCCTCGGGCGCG
ACAGTTTGCAGTTCCAGACCGATTGGCGGCGTTTCACCACGGCCTACAACGAACTGCTGGGTGGCCGCAT
GCCCGTGGCCGATCCCAAGGCGCCGTCGCGTGGCGTCGTGCCTCGGCCCGCCGCGACGGTGCAGGGAGTG
CAGGATGTGCTCGGGCGGTTTCAGTCGCTGCCCTCATACGAGTGGCCCCCTGGCGCGATCGCCGATTTTC
TGACGCGCTTTCGCGCCTGGGCTGAAGTGTTGCAGCCGCTTTGGTCGGCGACCGGCGAGTCTGGCTACCA
CCTCGCCTGGAACTTCCGGGTAAATCGGGGGGCGGAGGTTGCTGCCAACCAGATTATTTCCTGGACCTTG
TCCGTAGGCAGCGAATCCGTGGGCAGCGACATGCCAGACGCCCGCCTGCGCTGGGCGGTGGGATTGCCGA
TAACGCTGAGCGTGCGTCTGGCCAAGGACGCGCCGTTGCTGCCGCGGGCCGATCCCACTCAGCCGCGGAT
GTCGGTAGATGGCCATCAGGTCAGTTGGACCTTTCATGGGCCGTGGGCGCTATTCACGATGCTGGGCTGG
CAAGGGCTCGATAGCGGGCTGTTGCGGTTTGAGGTGCCGGTCATGGTGGAAAACATCAATGACTTTGCTC
GCTTGCCACCGGGTCAAAAGCTGAAGTTCTTCGTTGATCTGAATCTTTTCTCTCTCGGAGAGGGCAAGCC
GCTCAACTGGGCGCGGCCTTTGCCGCTCATCGCGCCAGCCGGGAGTGGCCCGTGA
 Primer design