SecReT6
Protein ID: 187919626
SecReT6 ID283
T6SS typei4b
Gene symbol-
Locus tagBphyt_4923
StrainBurkholderia phytofirmans PsJN
Repliconchromosome II [GenBank: NC_010676] [Browse all T6SS(s) in this replicon]
Location [Strand]1050281..1054147 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB2TC67
KEGG IDbpy:Bphyt_4923
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.10E-70, Aligned region: 189..449
ImcF-related_N [PF14331], Evalue: 2.10E-70, Aligned region: 1198..1236
IcmF-related [PF06761], Evalue: 1.80E-54, Aligned region: 494..846
DUF1215 [PF06744], Evalue: 4.10E-28, Aligned region: 978..1093
Protein Sequence: 1288 a.a.     [Download]
>gi|187919626|ref|YP_001888657.1| type VI secretion protein IcmF [Burkholderia phytofirmans PsJN]
MRRILNVLTHTRTLSIIGLLALAAVLFIGADTLQIDLMWPAIVLGAVIALWLLVWIVRRLRARRANRKLG
EMLEQQAEKQAEAGPAPTPARQAELDVLRTRLVDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRTEWLGFLGLLKRFRPKA
PINGIIVTASIAELTSSKPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSERHE
YDRVWGATLPYEPDEKRDVVGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALRA
FLATLFETNPFQYKPIFRGFYFTSALQEGETNSAAATRIANRFGLSSDGLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVKQFASPAKTRMRYATFFGFVAVLALALGGWTWSTVNNQQLTANVQADLDNVVRLQQNRNDL
QSRLQAMDVLEDRIDQLEQFRRDRPLAVSLGLYQGDRLEQRLLTEYYNGVRQILLDPVSQNLASFLKDVN
AHPDQLVPLNRAPDAAAIPVSTHSAMSANSQGGLYSDASPTNVEDAYNALKTYLMLSDKRHVETAHLTDQ
VARFWRGWLETNRGNMPRDEMIRSAERMITFYLARVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQR
VYEEIKARASTRFAPMTVARIVGENNTALVAGSYAIPGTFTREAWFQYVQPAIRDAATKELQAKDWVLNT
SAHDDLTLEGSPEQIQKALVAMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLET
AYDQTSWDNPSLFNANLKRAQTGVTSWVKNLFSRAPTGQINANIDINGNPVEVPMGPIGQEFSALGRIVV
SGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSELADSLKYVDEQMLTGLTDSQR
KALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQSFQNSLANKYPFASDAKVEAGAGEIAQVFGPDGA
IAKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPDFTSGFARWVAPLAGGAAGATAGQGSAEPQTVFQIL
PQPSSGTTEYTLAIDGQQMRYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLIN
SAQRKRRPDGTFDLSWTQGGVTVAVSMRIISTSQASSGSSDAPQQQSLRGLRLPSSVADVSAAANSVNAT
AAGAPAPATPATRPAAAATAVSNTGGAQ
 
Nucleotide Sequence: 3867 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c1054147-1050281 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGCGACGCATTCTCAACGTGTTGACCCACACACGCACGCTCTCGATCATCGGCTTGCTCGCGCTCGCTG
CTGTTTTATTCATCGGCGCCGATACCTTGCAGATCGATCTGATGTGGCCGGCCATCGTGCTCGGCGCCGT
GATCGCGTTGTGGCTGCTGGTGTGGATCGTGCGCCGCCTGCGCGCGCGCCGTGCGAACCGCAAGCTCGGC
GAAATGCTCGAGCAGCAGGCCGAGAAGCAGGCCGAGGCCGGTCCCGCGCCCACGCCCGCGCGCCAGGCTG
AACTCGACGTGCTGCGCACGCGTCTCGTCGATGCGGTGAAGACCATCAAGACCTCGAAGATCGGTCAGGT
CTCGGGCGGCTCGGCGCTCTATGAGTTGCCGTGGTACATCGTGATCGGCAACCCCGCCGCGGGCAAGAGC
AGCGCGGTATTGAACTCGGGCTTGCAATTCCCCTTCGCCGACAAGAACAACGCGGTGATCCACGGCATTG
GCGGCACGCGTAACTGCGACTGGTTCTTTACGACCGAAGGCATTCTGCTCGACACCGCCGGCCGCTATTC
CGTGCATGAGGAAGACCGCACCGAATGGCTCGGCTTTCTCGGGCTGCTCAAACGTTTCCGGCCGAAGGCG
CCGATCAACGGCATCATCGTCACGGCCAGCATTGCGGAACTGACCAGCAGCAAGCCTGAATTCGCGATCA
ATCTCGCGAAAAACCTGCGCCAGCGCGTGCAGGAATTGACCGAGAAGCTCGAAGTGTTCGCGCCGGTGTA
TGTGATGTTCACCAAGGCCGACCTGATTACCGGCTTCACCGAATTCTTCAGCGGCAGTGAGCGTCACGAA
TATGATCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCAGACGAGAAGCGCGACGTGGTCGGTTTGTTCG
ACGAACACTTCGAAGAGCTGTACGACGGCCTGAAAGAGATCAGCGTTGCGCAAATGTCGATCAATCGCGG
CAACAAGCTCTCGCCGGGTCAATTGAGCTTTCCACTCGAGTTCTCGACGATTAAGCCCGCGTTGCGCGCC
TTTCTCGCCACGCTGTTCGAGACCAATCCGTTCCAGTACAAGCCGATTTTCCGCGGCTTCTACTTCACGA
GTGCATTGCAGGAAGGCGAAACGAATAGCGCGGCGGCCACGCGCATCGCCAACCGTTTCGGCCTGAGTTC
GGACGGCCTGCCCAAGCCGCATAGCGCGTTCTCGAAGAACGGGTTCTTCCTGCGCGATCTGTTCTCGAAG
GTGATCTTTGCCGACCGGCAAACGGTCAAGCAATTCGCCAGCCCTGCCAAGACGCGCATGCGCTATGCGA
CCTTCTTCGGCTTCGTTGCGGTGCTCGCACTGGCGCTCGGCGGCTGGACCTGGTCCACGGTCAATAACCA
GCAGCTCACCGCGAACGTGCAAGCCGACCTCGACAATGTCGTGCGCCTGCAGCAGAACCGCAACGATCTG
CAATCGCGCCTGCAAGCCATGGACGTGCTCGAGGACCGCATCGATCAACTCGAACAGTTTCGCCGTGACA
GGCCGCTCGCGGTATCGCTCGGTCTGTATCAGGGCGATCGCCTCGAACAGCGTCTGCTCACCGAGTACTA
CAACGGTGTGCGGCAGATCCTGCTCGATCCGGTTTCGCAGAATCTCGCGTCGTTCCTGAAGGACGTCAAC
GCGCACCCCGACCAGCTCGTGCCGTTGAACCGCGCGCCGGACGCCGCCGCGATTCCGGTCTCCACCCACT
CGGCCATGAGTGCGAACAGCCAGGGCGGCTTGTATAGCGACGCCTCGCCGACCAACGTCGAAGATGCGTA
CAACGCGCTCAAGACGTATCTGATGCTGAGCGACAAGCGTCACGTGGAAACGGCTCACCTGACCGATCAG
GTCGCGCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACATGCCTCGTGACGAGATGATCCGCA
GCGCCGAGCGCATGATCACGTTCTACCTCGCGCGCGTGTCCGACGACGATTGGCCGATGATCGACCAGAA
TCTCGGCCTCGTCGATCAAACGCGAGAGAACTTGCGTCGCGTGGTGCGCGGCATGCCGGCGCGTCAGCGC
GTCTACGAAGAAATCAAGGCGCGCGCCTCGACCCGTTTCGCGCCGATGACGGTCGCGCGCATCGTCGGCG
AAAACAATACCGCGCTGGTGGCGGGCAGCTATGCGATCCCCGGCACCTTCACGCGTGAAGCCTGGTTCCA
GTACGTGCAGCCCGCCATTCGCGATGCCGCAACGAAAGAGTTGCAGGCAAAGGACTGGGTGCTTAACACA
TCGGCTCACGACGATCTGACGCTGGAAGGCAGCCCCGAACAGATCCAGAAAGCGCTCGTCGCGATGTACA
AGACCGAGTACGCGATGCACTGGCAGAAGTTCATGCAAGGCATTGCGGTGCAGAGCTTCGGCAGCTTCGG
CCAGGCCGTGGATGCAATGAACCGCTTGGGCGATCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAAACC
GCGTACGACCAGACTTCGTGGGACAACCCGTCGCTCTTCAACGCGAACCTGAAGCGCGCGCAAACCGGCG
TGACGAGCTGGGTCAAGAACCTGTTCTCGCGTGCGCCCACTGGCCAGATCAACGCGAACATCGACATCAA
CGGCAATCCGGTTGAAGTGCCGATGGGTCCGATCGGCCAAGAGTTCTCGGCATTGGGCCGCATCGTCGTG
AGCGGCGACAACGGTTCGATGCTCAAGGGCTATATGGACACGCTGTCGAAAGTCCGCACGCGCTTTAACG
TGATCAAGAATCAGGGCGATCCGGGACCGGGCGCGCGTCAACTGATGCAGCAGACGCTCGACGGCAGCGG
CTCCGAACTCGCCGATTCGCTGAAGTATGTCGACGAACAGATGCTCACGGGCCTCACCGACTCGCAGCGC
AAAGCGCTGCGTCCGCTGCTCGTGCGTCCGTTGATGGCGGCGTATGCGGTGGTGATCCAGCCGGCCAGCG
TCGAAGTCAACAAGGTGTGGAACGCGCAGGTGTATCAGAGCTTCCAGAACTCGCTCGCGAACAAGTACCC
GTTTGCCAGCGACGCGAAGGTCGAAGCCGGCGCCGGCGAAATCGCCCAGGTGTTCGGGCCGGACGGCGCG
ATCGCCAAGTTCGTCGGCACCACGCTCGGGCCGCTCGCGGTGCGCCGCGGCGACACGTTGACGGCCCGCA
CATGGGGCGACATGGGCCTTGCCCTCACGCCTGACTTCACGAGCGGCTTCGCGCGCTGGGTGGCGCCGCT
CGCCGGCGGCGCGGCGGGCGCAACGGCGGGCCAGGGTTCGGCCGAACCGCAGACCGTGTTCCAGATCCTG
CCGCAGCCAAGCAGCGGCACGACGGAATACACGCTGGCGATCGACGGCCAGCAGATGCGCTACCGCAACA
CGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAATCCGTCGGGCTCGCCTGGCGCGACATTGAGCGCCAC
GACCTTCGACGGCCGCACGCTGCAACTGGTCAACGAGCCGGGCCGCTACGGCCTGGAGAAGCTGATCAAC
TCGGCGCAGCGCAAGCGTCGTCCGGACGGCACGTTCGACCTGTCGTGGACGCAAGGTGGCGTGACGGTGG
CGGTCAGCATGCGCATCATCAGCACGTCGCAGGCGTCGAGCGGCAGCAGCGATGCGCCGCAACAGCAAAG
CCTGCGCGGCTTGCGGCTGCCGTCCTCGGTGGCGGATGTGAGCGCGGCGGCGAATTCGGTCAATGCGACG
GCCGCGGGTGCGCCCGCGCCGGCCACGCCCGCGACACGGCCGGCTGCGGCCGCCACCGCGGTTTCGAATA
CAGGGGGTGCGCAATGA
 Primer design