SecReT6
Protein ID: 187922935
SecReT6 ID284
T6SS typei3
Gene symbol-
Locus tagBphyt_0934
StrainBurkholderia phytofirmans PsJN
Repliconchromosome I [GenBank: NC_010681] [Browse all T6SS(s) in this replicon]
Location [Strand]1048323..1052312 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB2T0Q1
KEGG IDbpy:Bphyt_0934
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.60E-95, Aligned region: 611..931
ImcF-related_N [PF14331], Evalue: 2.60E-91, Aligned region: 295..563
DUF1215 [PF06744], Evalue: 2.30E-32, Aligned region: 1041..1164
Protein Sequence: 1329 a.a.     [Download]
>gi|187922935|ref|YP_001894577.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MKKLSFLVSRWFLAFLALLVLGLLIWFLGPFVAFGGLKPLVSVGMRVLVIALLLVGALLWLKGWSTGVVF
GALLCLLVWYAGPLLSFGRAAPLTSVAARVIAIGVVLALFAAFGLYWLWQKMRSDEAFLKKALTFGGKKE
TPPAAGRLKEVEARINAALARLKSMRTGARGVGRLFQGTRYLYELPWFIALGSTSSGKTSALLNAGLAFP
IGGATPRTAGASVGTKNIDWWLSNDAVLIDTAGYYTRHGASTQSLPALADKRAENKDDNKDDNAGCGTAA
TQGTDAAVGDADWRRRVDEDEWHGFLDLLRRHRPRAPINGAVLAISLDILTASDPAVRATEADMLRERLA
DLRTRLGIRFPVYLMITQMDRLSGFADYFGSLTEEHRAQMWGFTLPVNGQSARSDLAAVCNGELRQLVTR
LAGGVNTRLEDEYDIERRRRLAALPEAFAALCAPLAELLGQLFVDSRYDATQNHTMLRGVYFTSALQAGQ
TVTAEPLTVVQRLMAGRSRLFSADAARPAANHSYFLHDLFTKVVFPEAHLVRPNLRWEYRFRLLRLLGHT
LGLVLFVWLAMGMRVSFGNNSDYLDAIARKSQALAAKVTQLYREPKPEAVPDTLGEARYLPTWTGLDLSD
PDSRFRYGLYSAPGVVEASRDTYRALEDNLLLPSIVHRLEDVIAESMANKDAKATYGALRVYLMLYDKAR
FNSTDIKAWVLDDWAKNDSASIFGGRASMIEHVEQLFSGERIVQSPLIRNDGLIQQARAFLDGSNATQRL
YERAKADMQKEAPDEFTLLRAVGPQAGTVFTRVSGAPLSRGVPGLFTFDGYQNLFDKRLPEFVQAARDDD
AWVMGRSYLGEAQKKTAEIVSTVTGADDPLTEAIRRLYLTEYAQQWDAFLGDIRTVAGTSLAFNLQVLRQ
FAAPDSPLARLARAAVHETTLTQSIAAANGSLLQKTTDQFSQKADKALGIRAEERVERELVDGHFAALRE
MVTGSADTSAAEAPANAQAGKTGLDGVTSLLNDYYTTLTVADNAIANNSMPPASDAAAKLKMAANTMLAP
FRDVLLGLSVQGSREVNQGIGQLLSRQMQAVVSDTCRMTVEGNYPFAPDSPRDVSVDDFTRVFAQGGVID
DFFTKNLAPFVDTSAKPWRYRTLPGATDPVRGPDLEPFQHARQIRDVFFGDQGKQLLWKTDIRVPELDPT
VTTLAIDIDGQTMLYQHGPVAPFAVSWPGPRGGVHAEMTASPRIRNETSTLVTDGPWALMRLLRKGQIVQ
TATPGRTRAEFDFDGRKAVLDITGAGSVANPLTSEVLTTFRCPNSMSMFSLPDSGPPPGLPAADADRAH
 
Nucleotide Sequence: 3990 bp     [Download]
>gi|187922035|ref|NC_010681.1|:c1052312-1048323 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAAGAAGTTGTCGTTTCTGGTATCGCGCTGGTTCCTCGCGTTCCTCGCGCTGTTGGTCCTCGGACTGT
TGATCTGGTTTCTGGGGCCGTTCGTCGCGTTCGGCGGCCTCAAGCCTCTTGTTAGCGTCGGCATGCGCGT
CCTCGTGATCGCGCTGCTGCTCGTGGGCGCGCTGCTCTGGCTCAAGGGCTGGTCGACCGGCGTGGTGTTC
GGTGCGCTGCTGTGCCTGCTGGTCTGGTACGCAGGGCCGCTGTTGAGCTTCGGGCGTGCCGCGCCGTTGA
CCTCCGTCGCGGCGCGCGTGATCGCCATTGGCGTCGTGCTGGCGCTTTTTGCCGCATTCGGTCTGTACTG
GCTCTGGCAGAAAATGCGCAGCGACGAAGCGTTCCTCAAAAAAGCGCTGACGTTCGGCGGCAAGAAGGAG
ACGCCGCCGGCCGCCGGCAGGCTCAAAGAGGTCGAGGCTCGCATCAACGCCGCGCTCGCGCGGCTGAAGT
CCATGCGCACGGGCGCGCGAGGCGTGGGGCGGCTCTTCCAGGGCACGCGGTATCTGTACGAGCTGCCCTG
GTTCATCGCGCTCGGCTCGACCTCCTCCGGCAAGACGAGTGCATTGCTGAACGCCGGGCTGGCGTTTCCG
ATTGGCGGCGCGACGCCGCGAACGGCCGGCGCATCCGTCGGCACGAAGAACATCGACTGGTGGCTGTCGA
ACGATGCCGTTCTGATCGATACCGCGGGCTACTACACGCGACATGGCGCATCGACTCAGTCATTGCCCGC
GCTCGCGGACAAACGCGCCGAAAACAAAGACGACAACAAAGACGACAACGCCGGCTGCGGCACGGCCGCA
ACTCAGGGCACGGATGCCGCAGTGGGCGATGCCGACTGGCGTCGGCGTGTGGACGAAGACGAATGGCATG
GCTTTCTCGACCTGCTTCGCCGTCACCGCCCGCGCGCGCCGATCAACGGCGCGGTGCTCGCAATCAGCCT
CGACATACTGACGGCCTCCGACCCCGCGGTGCGCGCGACCGAAGCCGACATGCTGCGCGAACGGCTGGCC
GATTTGCGCACCAGGCTGGGTATCCGCTTTCCGGTGTACCTGATGATCACGCAAATGGACCGTTTGTCCG
GGTTCGCCGATTATTTCGGATCGCTGACCGAGGAACATCGCGCGCAGATGTGGGGATTCACGCTCCCGGT
CAACGGCCAATCGGCCCGGAGCGATCTCGCTGCGGTGTGCAACGGAGAACTGAGGCAGCTTGTCACGCGT
CTCGCCGGCGGCGTGAACACGCGGCTGGAAGACGAGTACGACATCGAGCGCCGCCGGCGCCTCGCGGCAC
TGCCGGAAGCGTTCGCCGCGCTCTGCGCTCCGCTTGCCGAGTTACTGGGGCAACTGTTCGTCGATTCACG
TTACGACGCTACGCAAAATCACACGATGCTACGAGGCGTCTATTTCACGAGCGCATTGCAGGCCGGGCAA
ACAGTCACTGCCGAACCGCTCACGGTCGTGCAGCGTCTGATGGCGGGGCGCAGTCGCCTGTTCTCGGCGG
ACGCGGCGCGGCCCGCCGCGAACCACAGCTATTTTTTGCACGATCTGTTCACGAAGGTTGTCTTTCCCGA
AGCGCATCTGGTGCGGCCCAATCTGCGCTGGGAGTACCGTTTCCGCCTGTTGCGGCTGCTCGGGCACACG
CTCGGCCTCGTATTGTTCGTGTGGCTCGCAATGGGCATGCGCGTGAGCTTCGGCAATAACAGCGACTATC
TGGATGCGATCGCGCGCAAGAGCCAGGCACTCGCGGCCAAGGTTACGCAGCTTTACCGCGAGCCCAAACC
GGAAGCCGTGCCGGACACGTTGGGCGAGGCGCGCTATCTGCCGACCTGGACAGGACTGGATCTGTCGGAT
CCCGACAGCCGCTTTCGCTATGGCCTCTACAGCGCGCCGGGTGTCGTCGAGGCGAGCCGCGACACCTATC
GCGCGCTCGAGGACAATCTGCTGCTGCCGTCCATCGTTCACCGCCTCGAAGACGTCATTGCTGAGTCGAT
GGCGAACAAGGATGCCAAAGCGACCTACGGCGCGTTGCGCGTCTACTTGATGCTGTATGACAAGGCGAGG
TTCAACTCGACCGATATCAAAGCCTGGGTACTCGACGACTGGGCAAAAAACGACAGCGCGTCGATCTTCG
GCGGACGGGCTTCGATGATCGAACACGTCGAGCAGTTATTTTCCGGCGAGCGTATCGTTCAGTCGCCGCT
GATCCGCAACGACGGCCTGATTCAGCAGGCCCGCGCATTTCTCGACGGCAGCAATGCCACGCAGCGGCTC
TACGAGCGCGCGAAGGCGGACATGCAGAAGGAGGCGCCCGACGAGTTCACGCTGCTTCGCGCGGTCGGAC
CGCAGGCCGGCACGGTGTTCACGCGTGTCAGCGGCGCACCGCTCTCGCGCGGTGTGCCGGGCCTCTTTAC
GTTCGACGGCTACCAGAACCTGTTCGACAAGCGGCTGCCGGAGTTCGTCCAGGCAGCGCGCGACGACGAC
GCCTGGGTCATGGGACGTTCGTATCTTGGCGAGGCTCAAAAAAAAACGGCTGAAATCGTAAGCACGGTAA
CGGGCGCCGACGATCCGCTGACGGAAGCCATCCGCCGGCTCTATCTGACCGAATACGCGCAGCAATGGGA
CGCTTTCCTCGGCGATATCCGCACGGTCGCCGGTACCAGCCTTGCCTTCAATCTGCAGGTGCTGCGCCAG
TTCGCTGCACCCGATTCGCCGCTGGCGCGCCTCGCTCGCGCAGCCGTGCATGAAACGACGCTCACCCAGT
CGATCGCCGCCGCCAATGGTTCTCTGCTGCAGAAAACGACCGACCAGTTCAGTCAGAAAGCGGATAAGGC
GCTGGGCATCCGCGCGGAAGAGCGCGTCGAGCGCGAACTGGTGGACGGCCATTTCGCCGCGCTGCGCGAG
ATGGTCACAGGCAGCGCCGACACCTCGGCCGCCGAGGCGCCGGCCAATGCTCAAGCCGGCAAGACAGGTC
TCGACGGCGTAACGAGCCTGCTCAACGATTACTACACCACACTGACGGTCGCGGATAACGCGATCGCGAA
CAACAGCATGCCGCCCGCCAGCGATGCCGCGGCAAAACTGAAAATGGCGGCCAACACCATGCTGGCGCCC
TTTCGCGACGTGTTGCTCGGCCTCTCGGTGCAGGGTTCGCGCGAAGTCAATCAGGGCATCGGGCAACTGC
TTTCGCGGCAGATGCAGGCCGTGGTCAGCGATACGTGCCGAATGACCGTGGAGGGCAACTATCCTTTTGC
GCCGGACAGTCCGCGCGACGTGAGTGTCGACGACTTCACACGCGTATTCGCACAGGGCGGCGTGATCGAC
GACTTCTTCACGAAGAACCTCGCACCGTTCGTCGATACCTCGGCGAAGCCGTGGCGCTACAGAACGCTGC
CGGGCGCCACCGATCCCGTACGGGGCCCCGACCTCGAACCATTCCAGCACGCGAGGCAAATCCGCGACGT
GTTCTTCGGCGACCAGGGCAAGCAACTTCTTTGGAAAACTGACATCCGCGTGCCCGAACTCGATCCGACC
GTGACGACGCTGGCAATCGACATCGACGGTCAGACCATGCTGTATCAGCACGGACCCGTCGCACCATTCG
CGGTGAGCTGGCCTGGGCCGCGCGGCGGCGTGCATGCCGAAATGACCGCGAGCCCACGCATTCGCAATGA
AACCTCGACGCTCGTGACGGACGGCCCGTGGGCACTCATGCGTTTGCTGCGCAAGGGGCAGATTGTCCAG
ACGGCCACGCCGGGGCGCACCCGCGCGGAGTTCGATTTCGACGGACGCAAGGCGGTGCTCGATATCACCG
GTGCGGGCAGCGTCGCCAACCCGCTGACCAGCGAAGTGCTCACGACCTTCCGTTGCCCGAATTCGATGTC
GATGTTCAGCCTGCCTGACAGCGGGCCGCCGCCCGGCTTGCCGGCGGCGGATGCCGACCGCGCTCATTGA
 Primer design