SecReT6
Protein ID: 188532761
SecReT6 ID285
T6SS typei3
Gene symbol-
Locus tagETA_06140
StrainErwinia tasmaniensis Et1/99
Repliconchromosome [GenBank: NC_010694] [Browse all T6SS(s) in this replicon]
Location [Strand]675194..678823 [+]
Producthypothetical protein
NoteTssM
UniProt IDB2VH70
KEGG IDeta:ETA_06140
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.60E-102, Aligned region: 207..487
IcmF-related [PF06761], Evalue: 3.50E-85, Aligned region: 535..838
DUF1215 [PF06744], Evalue: 9.10E-31, Aligned region: 951..1074
Protein Sequence: 1209 a.a.     [Download]
>gi|188532761|ref|YP_001906558.1| hypothetical protein ETA_06140 [Erwinia tasmaniensis Et1/99]
MLNMLFAVLTHRLLWGFVGITALSFIIWVIGPVFSIADSRPLEPEVNRQISIGLLYLVWALGNLVPRLYN
AWLNRKLMGSLKTTPGEQPDGDNPRLTSEDRVLAERFSEASELLKKAHFSHAGSRSPFWAQRFSRQYLYQ
LPWYVIIGAPGAGKTTALVNSGLQFPLADRFGKSALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQQ
QDAGEWHGFINLLRKYRGRQPINGVIVTVSVSDLLTQSAEAARQQAVALRQRLTELHEQLGIRFPVYVLV
TKADLLKGFRAYFAKFDKAQREQIWGFTFPWERAKMSDFDLQAAFTQEYALLQQRLDAGLPDTLLQESDS
QARAESFLFPQEFAALRPLLAEYLDTVFALSDFETQFSPRGIYFASGTQEGLPFDRVMGELNRALQLPQQ
DAASGQSGSWDQTSKYAPIPGNKGQSFFLKDVLQKVIFAEAGLAGSNRWWELRNRALLWSGYIALAAVMV
ISALLWFTSYGNNKSYLQQVQARVPEVARQSATLEGSEQGDLFALLPFLNSLLKLPESSEFDLNSPPISR
RMGLYRGAEVSDATQALYQKSLKQLLLPQVAQLITGWLRNDNGSDADYSYEALKAYQMLYQPPHYDGKFL
HAWLMLNLQRNLPQNVTQTQLKQLEWHLSQLLENQIQSSPYARDDALVKREQALINQMPLSQRVWGRLKR
LLERDESLKAVSLASLGGPQSELVFSRKSGRSIADGIPGLFTPDGYWQSLDKHIAPVTTALHDDDRWVLG
APSSGESQQQTDAAVRQLYIGDYIRQWDSLLQDIQLNNSADLSQRINSARLLSSNNSPLRRLVINLSRYL
VLEKLPTDEKPPGKEKDAEADNSATRTLQALFRSRQNSTAAAAEQAPEQAVANHFAPVIELAQPLEQGGK
TIAFDDFLRQIDDLYRYLTAVQDAANSGMPPPAGDAISHLQASAGRLPGSLQTMFSTLAVGASSDAQRRE
LENVRKRISSEVGGFCRQAIAGRYPLVRSARSEVTPDDLARMFAPGSGLMDSFFRDNLANKVDTTQSAWR
FTPGIDGKGIGGEDILRPFQQAQSVRDAFFANGATTPAFRVTVRTLRMDNDILNLTLDVDGQLLRYSHGP
QAVQLMNWPGSGGTSQVRMQLGLANGTTSTLVTNGVWALNRFFDRAQLAPGSSSLSRQATFNVDGHRVTL
EFTPNSIRNPFQLSGFACP
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|188532165|ref|NC_010694.1|:675194-678823 Erwinia tasmaniensis Et1/99 chromosome, complete genome
ATGTTGAATATGCTGTTTGCCGTTTTAACCCATCGCCTGCTGTGGGGCTTTGTCGGGATCACCGCGCTGT
CGTTTATTATCTGGGTCATCGGCCCGGTATTTTCGATTGCAGACTCGCGGCCGCTGGAGCCGGAAGTTAA
CCGCCAGATCAGTATCGGCCTGCTCTATCTGGTGTGGGCGCTGGGTAACCTGGTGCCGCGCCTGTATAAC
GCCTGGCTGAACCGTAAGCTGATGGGCAGCCTGAAAACCACCCCCGGCGAACAGCCGGACGGTGATAATC
CGCGTCTGACCAGCGAAGATCGGGTGCTGGCGGAACGCTTTAGCGAAGCCTCCGAGCTGCTGAAAAAGGC
GCACTTCTCCCATGCCGGTAGCCGTTCGCCGTTCTGGGCGCAGCGCTTCAGCCGCCAGTACCTTTACCAG
CTGCCGTGGTATGTGATTATCGGCGCGCCGGGAGCCGGGAAAACCACCGCGCTGGTCAACTCCGGGCTGC
AATTTCCGCTGGCCGACCGCTTTGGCAAATCCGCGCTGCGCGGCATTGGCGGCACGCGTAACTGTGACTG
GTGGTTTACCAATGAAGCGGTGCTGCTCGATACCGCCGGACGCTACACCACCCAGGAGAGCCAGCAGCAG
CAGGATGCCGGAGAATGGCACGGCTTTATTAACCTGCTGCGCAAATACCGGGGTCGCCAGCCGATCAACG
GCGTGATCGTGACCGTCAGCGTCTCCGATCTGTTGACCCAGTCGGCAGAGGCGGCACGGCAGCAGGCGGT
GGCGCTACGCCAGCGTCTGACCGAGCTGCATGAACAGCTGGGCATTCGTTTCCCGGTGTATGTGCTGGTC
ACCAAAGCCGATCTGCTGAAAGGCTTCCGCGCCTACTTTGCCAAATTCGACAAGGCCCAGCGCGAACAGA
TTTGGGGCTTCACCTTCCCGTGGGAACGGGCAAAGATGAGCGATTTTGACCTACAGGCGGCCTTCACCCA
GGAGTACGCCCTGCTGCAACAGCGGCTGGATGCCGGGCTGCCGGATACGCTGCTCCAGGAGAGCGATAGC
CAGGCGCGCGCCGAAAGTTTCCTGTTCCCGCAGGAGTTCGCCGCGCTGCGTCCGCTGCTGGCGGAGTACT
TGGACACGGTGTTTGCCCTTTCAGATTTTGAAACCCAGTTCTCACCGCGCGGCATTTACTTTGCCAGCGG
CACCCAGGAAGGGCTGCCGTTTGACCGGGTGATGGGCGAGCTTAACCGCGCCTTACAGCTGCCGCAGCAG
GATGCGGCCAGCGGCCAGAGCGGAAGCTGGGACCAGACCAGCAAATATGCGCCGATCCCCGGCAACAAGG
GGCAAAGCTTCTTCCTGAAAGACGTGCTGCAAAAAGTGATCTTTGCCGAGGCCGGGCTGGCGGGCAGCAA
CCGCTGGTGGGAGCTGCGCAACCGGGCGCTGCTGTGGTCGGGCTATATCGCCCTTGCCGCCGTAATGGTC
ATCAGCGCGCTGCTGTGGTTCACCAGCTACGGCAACAACAAAAGCTATCTGCAACAGGTGCAGGCGCGGG
TGCCGGAGGTGGCGCGGCAAAGCGCTACGCTAGAGGGCAGCGAGCAGGGCGATCTGTTTGCGCTGCTGCC
GTTCCTTAACAGCCTGCTGAAGCTGCCGGAAAGCAGTGAGTTTGACCTGAACTCGCCGCCGATAAGCCGC
CGTATGGGGCTGTATCGCGGGGCCGAGGTCAGCGATGCCACCCAGGCGCTGTATCAGAAATCACTGAAAC
AGCTGCTGCTGCCGCAGGTGGCGCAGCTGATCACCGGCTGGCTGCGCAACGATAACGGCAGCGACGCCGA
CTACAGCTATGAAGCGCTGAAAGCCTATCAGATGCTGTATCAGCCGCCGCACTATGACGGCAAGTTCCTG
CATGCCTGGCTAATGCTCAACCTGCAACGCAACCTGCCGCAAAACGTCACGCAGACGCAGCTAAAACAGC
TGGAGTGGCACCTCAGCCAGCTGCTGGAAAATCAGATCCAGTCCTCTCCCTATGCGCGGGATGATGCGCT
GGTAAAGCGCGAGCAGGCGCTGATTAATCAGATGCCGCTGTCACAGCGCGTCTGGGGGCGGCTCAAGCGC
CTGCTGGAACGTGATGAAAGCCTGAAAGCGGTGTCGCTGGCCTCGCTCGGCGGGCCGCAGAGCGAGCTGG
TATTCTCGCGCAAAAGCGGGCGCTCAATTGCCGATGGCATTCCCGGCCTGTTTACCCCGGACGGCTACTG
GCAGAGCCTGGATAAACATATCGCGCCGGTCACCACAGCCCTGCATGACGATGACCGCTGGGTGCTGGGC
GCACCGTCCAGCGGCGAAAGCCAGCAGCAAACCGATGCCGCGGTACGCCAGCTGTATATCGGCGACTATA
TCCGCCAATGGGACAGCCTGCTACAGGACATTCAGCTGAATAACAGCGCCGATCTCAGCCAGCGCATCAA
CAGCGCGCGCCTGCTCTCCAGCAATAACTCGCCGCTGCGCAGGCTGGTGATTAACCTCAGTCGCTACCTG
GTGCTGGAAAAGCTGCCCACGGATGAGAAGCCGCCGGGCAAAGAGAAGGACGCAGAGGCCGATAACAGCG
CCACCCGCACCCTACAGGCGCTGTTCCGCTCACGGCAGAACAGCACGGCGGCGGCGGCAGAGCAGGCACC
TGAACAGGCGGTGGCCAACCACTTTGCGCCGGTTATCGAACTGGCGCAGCCGCTGGAGCAGGGCGGTAAA
ACCATCGCCTTTGATGACTTTCTTCGCCAGATAGATGACCTGTATCGCTATCTGACGGCGGTGCAGGATG
CCGCCAACAGCGGCATGCCGCCGCCAGCGGGTGATGCCATCAGCCACCTGCAGGCCAGCGCCGGACGCTT
ACCCGGTTCGCTGCAAACCATGTTCTCCACGCTCGCGGTCGGTGCCAGCAGTGACGCCCAGCGCCGCGAA
CTGGAAAACGTGCGCAAACGCATCAGCAGCGAGGTCGGCGGCTTCTGCCGTCAGGCGATTGCCGGACGCT
ACCCGCTGGTGCGCTCGGCGCGCAGCGAAGTGACCCCGGATGACCTGGCGCGCATGTTTGCCCCCGGCAG
CGGCCTGATGGACAGCTTCTTCCGCGATAATCTTGCCAACAAAGTCGATACCACGCAGTCGGCCTGGCGC
TTTACGCCGGGCATTGACGGCAAGGGCATCGGCGGCGAAGACATTCTGCGCCCGTTCCAGCAGGCGCAAA
GCGTGCGTGATGCGTTCTTTGCCAACGGTGCCACCACCCCGGCGTTTCGCGTGACGGTACGCACGCTGCG
CATGGATAACGATATTCTTAACCTGACGCTGGACGTCGACGGCCAGCTGCTGCGCTACAGCCACGGGCCG
CAGGCGGTACAGCTGATGAACTGGCCGGGCAGCGGCGGCACCAGCCAGGTGCGCATGCAGCTTGGACTGG
CGAACGGCACCACCTCGACGCTGGTGACCAACGGCGTCTGGGCGCTGAATCGCTTCTTTGACCGGGCGCA
GCTGGCGCCGGGCAGCAGCAGCCTGAGCCGCCAGGCCACCTTTAACGTAGACGGCCACCGCGTGACGCTG
GAGTTCACTCCAAACAGCATCCGCAATCCGTTTCAGCTTTCCGGGTTCGCATGCCCGTAG
 Primer design