SecReT6
Protein ID: 188575823
SecReT6 ID286
T6SS typei3
Gene symbolsciS
Locus tagPXO_00250
StrainXanthomonas oryzae pv. oryzae PXO99A
Repliconchromosome [GenBank: NC_010717] [Browse all T6SS(s) in this replicon]
Location [Strand]1611016..1614474 [+]
ProductSciS protein
NoteTssM
UniProt IDB2STH5
KEGG IDxop:PXO_00250
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-88, Aligned region: 197..459
IcmF-related [PF06761], Evalue: 1.80E-68, Aligned region: 510..809
DUF1215 [PF06744], Evalue: 2.80E-26, Aligned region: 896..1017
AAA_16 [PF13191], Evalue: 0.0022, Aligned region: 116..261
AAA_16 [PF13191], Evalue: 0.0022, Aligned region: 292..349
AAA_16 [PF13191], Evalue: 0.0022, Aligned region: 544..587
AAA_16 [PF13191], Evalue: 0.0022, Aligned region: 777..840
Protein Sequence: 1152 a.a.     [Download]
>gi|188575823|ref|YP_001912752.1| sciS gene product [Xanthomonas oryzae pv. oryzae PXO99A]
MRFVLDFLRVRYLASAAILSLLALLVWVGGPYLSLGRWQPFASVSGRLLAMAVLVLAWAGWRYLRWRRDS
AKQQRLAAELVGQGARAEDASGNDSRARAAHEQVRLRARFTEAMAVLRRRRRNGPGLHVLPWYLLIGAPG
SGKSTLLQSSGLEFPLKAHGTHAALEGVGGTRNCDWWFADQAVFLDSAGRYTTQDSDAIADAGAWHGFLD
LLRRHRRQPLNGVIVTVSVAELLELDGDAGLSHARAVRHRLNELVEKLRARVPVYLIVTKCDLVSGFAEF
FADLDAAGRAQVWGVSFPQAQAAGDTDPLTRFPTELERLLERIDQRVLERLHRARDARERAAVLSFPQQL
RLLQPALMDVVQTAFGRHGYAGQPWLRGVYLSSGTQQGHPIDHVISAVAQHFGVAAAGLPPVSSAPRSYF
LSRLLKDVVFAEAGLAGSQPGSAQRRRLLQLACWAVLTATTLGVLSGMAGSYARNVRLIGQVRDALDAYP
AGPLPADAGEAAFYAKALQRFDALAQARDAALPPGASIPWSRRFGLHQGTALARDVQEAYLRDLNGALLP
ALAQSLRRKLEQSSNDPQRLYPLLKGYLMLGDPTRRDAMHLATLAGTVWRQIFPDDASVRAGLNLHLRAL
LGPVDGARALALDRQQIEQTRASLRTAELPALVYGGLKLTQPGVDAGQAPRLDRRLGLLSDVFERRSGLP
LSAPLPPLFTRQAFQAQIGGGIAHGVQQFLADDWVLGTAPLDPLARSQLEREVLALYQRDYIAAWDSLLA
DLVLRPVVQTGQASAVAAKLGGPASPLKALLVLLREHTHALGRTPAAKAGAGAAAAADTAAAAEPDVAAE
PIERHFEPLTRLLDGGPGASALDETLAALTQMSRTLLGAAAGVAADQNAPALLIAAQQAEQLPPPLGNWM
ATLSGRGRALTASSAGEALRNAQRQAAGRECALLVSGRFPFVPGSNNEIPLRDFAELFAPGGRMDRFAQQ
ALLGKVDTSGPGWKWNAGMAAAGADDVLARAQLADEIKQAFFAGGGAQPQVAFTVSIPPQAGIRRLQLEV
DGQALDVRDGARATQSMTWPGPTPGLVRLAAWDASGQALPVVEYRGPWAWFRVMQAGRLHRSGDLDYTAS
LALGGTSVRVDIQPASLRHPFAASAVQRFSCP
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|188574270|ref|NC_010717.1|:1611016-1614474 Xanthomonas oryzae pv. oryzae PXO99A chromosome, complete genome
ATGCGCTTTGTGCTCGATTTCCTGCGCGTGCGCTACCTCGCCAGCGCTGCCATCCTCAGTCTGTTGGCCC
TCCTGGTGTGGGTCGGCGGACCCTATCTCAGCCTGGGCCGCTGGCAGCCGTTTGCCAGCGTGAGCGGGCG
CCTGCTTGCCATGGCCGTGCTGGTGCTCGCGTGGGCAGGGTGGCGCTATCTGCGCTGGCGCCGCGACAGC
GCCAAGCAGCAACGTCTGGCCGCCGAACTGGTCGGGCAGGGAGCACGTGCCGAAGACGCCAGCGGCAACG
ACAGTCGCGCGCGTGCAGCACACGAGCAGGTCCGCCTGCGTGCGCGCTTTACCGAAGCCATGGCGGTGCT
GCGCCGTCGCCGTCGCAACGGTCCCGGCCTGCACGTGCTGCCCTGGTATCTGCTGATCGGCGCGCCCGGT
TCCGGCAAGAGCACCTTGCTGCAGTCTTCGGGCCTGGAGTTCCCCCTCAAGGCACATGGCACCCACGCCG
CGCTGGAAGGTGTCGGTGGCACGCGCAACTGCGATTGGTGGTTCGCCGACCAAGCAGTGTTCCTCGACAG
TGCCGGGCGCTATACCACCCAGGATTCGGACGCCATCGCCGATGCCGGTGCCTGGCATGGCTTTCTGGAC
CTGCTGCGGCGGCATCGCCGGCAGCCATTGAACGGCGTCATCGTGACCGTGAGCGTGGCCGAGCTGCTGG
AGCTCGATGGCGATGCCGGTCTGTCGCACGCGCGGGCAGTACGTCATCGACTGAACGAACTGGTCGAGAA
ACTGCGCGCACGCGTGCCGGTCTACCTGATCGTGACCAAATGCGATCTGGTGTCGGGCTTCGCCGAATTC
TTCGCCGATCTGGATGCCGCCGGCCGCGCGCAGGTGTGGGGGGTGTCGTTCCCACAGGCGCAGGCCGCCG
GTGACACCGATCCGTTGACGCGATTCCCCACCGAGCTCGAACGCCTGCTGGAGCGGATCGATCAGCGCGT
GCTGGAGCGCCTGCATCGGGCGCGCGATGCACGCGAGCGTGCCGCGGTGCTGTCCTTTCCGCAGCAATTG
CGGTTGCTTCAGCCAGCGCTGATGGACGTCGTGCAGACCGCGTTCGGCCGCCATGGCTATGCCGGCCAGC
CGTGGCTGCGTGGTGTCTATCTGAGCTCGGGGACGCAGCAAGGCCATCCGATCGACCACGTCATCTCGGC
AGTGGCGCAACACTTCGGTGTTGCCGCCGCCGGTCTGCCGCCCGTCAGCAGCGCACCACGCAGTTACTTC
CTGTCACGCCTGCTCAAGGACGTGGTCTTCGCCGAGGCGGGACTGGCCGGCAGCCAACCCGGCAGCGCGC
AGCGCCGTCGGTTGCTGCAGCTGGCCTGCTGGGCCGTGTTGACCGCCACCACCCTGGGCGTGCTGTCGGG
CATGGCCGGCAGTTACGCCCGCAACGTGCGGCTGATCGGGCAGGTGCGCGACGCGCTCGATGCCTATCCC
GCCGGCCCGCTGCCCGCCGATGCAGGCGAGGCGGCCTTCTATGCAAAAGCCTTGCAGCGTTTCGACGCAT
TGGCGCAGGCGCGCGATGCGGCGCTGCCGCCGGGCGCGTCGATTCCGTGGTCGCGACGTTTCGGGCTGCA
CCAGGGCACGGCCTTGGCGCGCGATGTGCAAGAAGCGTATCTGCGCGACCTCAATGGCGCGTTGCTGCCG
GCATTGGCGCAATCGCTGCGACGCAAGCTGGAGCAGTCCAGCAACGATCCGCAACGTCTGTATCCATTGT
TGAAGGGCTATCTGATGCTGGGAGACCCGACACGGCGCGATGCAATGCATCTGGCCACGCTGGCAGGCAC
GGTCTGGCGCCAGATATTTCCCGACGATGCATCGGTGCGTGCGGGGTTGAACCTGCATCTGCGCGCCTTG
CTGGGTCCGGTGGACGGCGCGCGCGCGCTTGCGCTGGATCGGCAGCAGATCGAGCAGACACGGGCGAGCC
TGCGAACCGCCGAACTGCCGGCACTGGTCTACGGTGGCCTCAAGCTGACGCAGCCCGGGGTCGATGCCGG
CCAGGCCCCACGCCTGGATCGCCGCCTGGGCCTGCTGAGTGATGTCTTCGAACGCCGCAGTGGCCTGCCG
TTGTCTGCGCCATTGCCCCCGCTGTTCACCCGTCAAGCGTTTCAAGCACAGATCGGCGGTGGCATCGCGC
ATGGCGTGCAGCAGTTTCTCGCCGACGATTGGGTGTTGGGCACGGCACCGCTGGACCCGTTGGCGCGCTC
GCAACTGGAGCGCGAGGTATTGGCGCTGTATCAGCGCGACTACATCGCCGCCTGGGACAGCCTGCTGGCC
GATCTGGTGTTGCGGCCGGTCGTGCAGACCGGGCAGGCGAGTGCGGTGGCCGCCAAGCTGGGTGGACCGG
CATCGCCGCTGAAGGCGTTGCTGGTGTTGCTGCGCGAGCACACCCACGCACTGGGGCGCACGCCTGCAGC
GAAGGCCGGCGCGGGCGCTGCAGCTGCCGCGGACACTGCTGCTGCGGCCGAGCCGGATGTGGCAGCCGAA
CCGATCGAACGCCATTTCGAACCGCTCACTCGCCTGCTCGATGGTGGGCCGGGCGCCAGTGCGCTGGACG
AAACCCTGGCCGCGCTGACCCAGATGAGCCGCACGCTGTTGGGAGCCGCCGCTGGCGTGGCTGCCGACCA
GAACGCCCCGGCCTTGCTGATCGCCGCGCAACAGGCCGAACAGCTGCCGCCGCCGCTGGGCAACTGGATG
GCGACCTTGTCCGGTCGTGGTCGCGCATTGACCGCCAGCAGCGCCGGCGAAGCATTGCGTAACGCGCAAC
GGCAAGCCGCCGGGCGTGAGTGCGCGCTGCTGGTGAGCGGGCGTTTCCCGTTCGTGCCGGGCAGCAACAA
CGAGATCCCGCTGCGCGATTTCGCCGAACTGTTCGCACCCGGTGGGCGGATGGACCGGTTCGCGCAACAG
GCGTTGCTCGGCAAGGTCGATACCAGCGGGCCTGGCTGGAAATGGAATGCAGGCATGGCTGCGGCTGGCG
CAGACGACGTGCTGGCGCGCGCGCAACTGGCCGACGAGATCAAGCAAGCATTCTTCGCCGGCGGCGGTGC
GCAGCCGCAGGTCGCCTTTACTGTTTCCATTCCACCGCAAGCAGGGATTCGCCGGCTGCAGCTGGAGGTG
GATGGGCAAGCGCTGGACGTGCGCGATGGTGCGCGCGCCACCCAGTCGATGACCTGGCCTGGTCCAACGC
CAGGTCTGGTGCGTCTGGCGGCGTGGGACGCCAGCGGACAGGCTTTGCCAGTGGTCGAATACCGCGGCCC
CTGGGCCTGGTTTCGGGTCATGCAGGCCGGGCGGCTGCACCGCAGCGGCGATCTGGATTACACCGCCAGC
CTCGCGCTGGGCGGCACCAGCGTGCGCGTGGACATACAACCGGCCAGCCTGCGGCATCCCTTTGCGGCGT
CGGCCGTGCAGCGGTTCAGTTGCCCATGA
 Primer design