SecReT6
Protein ID: 189349183
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00300
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]314346..315128 [-]
Producthypothetical protein
NoteTssL
UniProt IDA9AK69
KEGG IDbmj:BMULJ_00300, bmu:Bmul_2934
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-57, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|189349183|ref|YP_001944811.1| hypothetical protein BMULJ_00300 [Burkholderia multivorans ATCC 17616]
MSYAPSLFGDNAPTPVHTPSSTDAAFQARSLLDLLYDGFFMLFLLKNGREPESASEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDRIAHRLKREVPVW
AIGAVFALVALLGYLGLNAYLKGKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c315128-314346 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGCGCCGACACCCGTGCATACCCCGTCGTCGACGGACG
CCGCGTTTCAGGCGCGTTCGCTGCTCGATCTGCTGTACGACGGCTTTTTCATGCTGTTTCTGTTGAAGAA
CGGGCGCGAGCCCGAGAGCGCGAGCGAGTTCAGCACGCGGATTCAGGAGTTTCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTCAATATCGCGGCCGAAGATGTGTACGGCGCGAAGTTCGCGTACTGCGCGGCCGTCG
ACGAGATGGTGCTGTCGTCGCAGTTCAAGATTCGCGCGGACTGGGAGCGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTGGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAGTGCCGTGCGCAAGGCGCGGCG
CGGCTCCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGATTCCAGGGCAAGTATCTGCTCGAAG
GGCCGGAGAAGCTGGCTTATCTGACCGCGCGGCTGGGCGACGAGATCGCGCATATGAAAGGCAAGCGTGC
GCCGTTCGCGCCGCATTGGCCGCTGCCGGATCGGATCGCGCATCGGCTCAAGCGCGAAGTGCCGGTGTGG
GCGATCGGGGCGGTGTTCGCGCTCGTCGCGCTGCTCGGGTATCTCGGGCTCAATGCGTATCTCAAGGGCA
AGACGCTGCAGGCGTTGGCGCCTTATTCGCAGGTGATCAAGGTCGGGCCGGAGTCGGCGAATTTGACGAT
TTCGTTGCCTTGA
 Primer design