SecReT6
Protein ID: 189349184
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00301
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]315125..316471 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9AK68
KEGG IDbmj:BMULJ_00301, bmu:Bmul_2933
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|189349184|ref|YP_001944812.1| hypothetical protein BMULJ_00301 [Burkholderia multivorans ATCC 17616]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGLRTLRIDHDALGSNVLRVAELALVFP
DGTLYAAPQGDDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFTTRFVSQQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEVDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYSLADLPVYRHDDPGPGFARLDVMLRELLGTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c316471-315125 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGAGAAGGGCTGTTCCTCCGGCCTCAACATTTTCAGCGGCAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGGCTGCGCAC
GCTGCGGATCGACCATGACGCGCTCGGCAGCAACGTGCTGCGCGTCGCCGAACTCGCGCTCGTGTTCCCC
GACGGCACGCTGTACGCGGCGCCGCAGGGCGACGATCTGCCGCCGCCGATCGCGCTCGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTGGCGCTGCACCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCACGACGCGCTTCGTCAGCCAGCAGACCAGCGTCGCCGACAACTTCACCGAC
GCGGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCCGTGCCGCTCGTGCGCGTGCGGCGCACCGCGACGTCCGGATTCGAGGTCGACGATAGCTT
CGTGCCGCCGTGCCTGGCGATTGAGGCATCGCCGATTTTGCATCAGCGGCTGCGCCAGCTCGTCGACGCG
CTGCAGGCGAAGGTCAATGCGCTGTACGGCTTTCATCGCGAGCCGTCGAAAAACATCATCGAATTCCGCT
CGGGCGACATTGCGTCGTTCTGGCTGCTCCACACGGCGAACGCCGCGTTCGCGACGCTCGCGCACCTGCA
TCAGCACGCGGCGCTGCATCCCGAACGGCTGTTCCAGGAGCTGCTGCGGCTCGCGGGACAGCTGATGACG
TTCTCGAAAGGCTATTCGCTCGCCGATCTGCCCGTCTATCGCCACGACGATCCGGGCCCCGGCTTCGCGC
GTCTGGACGTGATGCTGCGCGAACTGCTCGGCACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
CGAGGTGCGGCCGTCGTTCCATCTCGGCCGGCTCGACTCGGGCAAGATCGACGACAAGACCGAGTTCTAT
CTCGCCGTATCCGCCGACATGCCCAGCGTCGAGCTCGTCGATGCCGTGCCTGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCCGCAATGCCGGGCGTACGGCTCTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGGCCGGGCGCGTGCTACTTCGCGCTCGATTCGCGCGGCGCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAACGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA
 Primer design