SecReT6
Protein ID: 189349185
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00302
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]316574..317185 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA9AK67
KEGG IDbmj:BMULJ_00302, bmu:Bmul_2932
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.70E-38, Aligned region: 15..175
Protein Sequence: 203 a.a.     [Download]
>gi|189349185|ref|YP_001944813.1| putative lipoprotein [Burkholderia multivorans ATCC 17616]
MRSPMIRYGLPLIACALLAGCAAAPLLGSAASAVMSATGIGKPEVPDSQKPPRNIGLTLAAAPNLNAATD
NKPLALVVRLYALKDPTSFQQAPFDAFTDPNKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIAPQQGAPSQPLNMLSSVSCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c317185-316574 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAGATCGCCCATGATTCGCTACGGATTGCCGTTGATCGCCTGCGCGCTGCTGGCCGGATGCGCCGCCG
CGCCGCTGCTCGGATCGGCCGCAAGCGCCGTGATGTCGGCCACCGGCATCGGCAAACCCGAGGTGCCGGA
CTCGCAAAAACCGCCGCGCAACATCGGCCTCACGCTCGCTGCCGCGCCGAATCTGAATGCGGCGACCGAT
AACAAGCCGCTCGCGCTCGTCGTGCGGCTTTACGCGCTGAAAGACCCGACTTCGTTCCAGCAGGCGCCGT
TCGACGCATTTACCGATCCGAACAAGGAAAAAGCGGCGCTCGGCGCCGATTTGCTCAACGTTCGTGAAAT
CACGCTGATTCCCGGGCAGCGCTATACGGCGACCGAGAAAGTGTCGCGCGAAGCGCAGGCATTCGGCATC
GTCGCGCTGTTCCGCGATCCCGCACTGCAGCGATGGAAGCTGACATTCGACCCGGCGAAGTCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCAATGACGGTGACCGGGGGCACGGTGATCGCACCGCAACA
GGGCGCGCCTTCGCAACCGCTGAATATGCTGTCGTCGGTCAGTTGCGGTTAA
 Primer design