SecReT6
Protein ID: 189349187
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00304
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]318229..318744 [+]
Producthypothetical protein
NoteTssB
UniProt IDA9AK65
KEGG IDbmj:BMULJ_00304, bmu:Bmul_2930
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.70E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|189349187|ref|YP_001944815.1| hypothetical protein BMULJ_00304 [Burkholderia multivorans ATCC 17616]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFNPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQALAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|189348893|ref|NC_010804.1|:318229-318744 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGGCCAAGAAAGAGAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGCGGATCTGGC
CGGCCAGTCCGAAGTCGAGCAGCCGAAGCTTCGCGATCGCAAATTCGTCAACATCGATCGCGACAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCGGCGTTCCAGGTGGAAAACCGGCTGAGCCCCGAGGGCG
GCAAGTTCGCGGTCGACCTGAAATTCCGTTCGCTGTCGGATTTCAATCCGGACGAAGTCGTCGAGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGACCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGCGCTCGCGAAGGGCA
CGGGCGGCGACAAAGACGGCGAATGA
 Primer design