SecReT6
Protein ID: 189349188
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00305
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]318760..320250 [+]
Producthypothetical protein
NoteTssC
UniProt IDA9AK64
KEGG IDbmj:BMULJ_00305, bmu:Bmul_2929
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|189349188|ref|YP_001944816.1| hypothetical protein BMULJ_00305 [Burkholderia multivorans ATCC 17616]
MNQQTAPAQASGAEYAAGTSLLDEIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVVVSDNLSATIDAR
VAELDRLISAQLSAVMHAPEFQRLESTWRGLDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGQTAETFNFVEDVDGTDHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|189348893|ref|NC_010804.1|:318760-320250 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTCCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGCTGCTCGACG
AAATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGCGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGGTCGTGTCGGACAACCTGTCGGCGACGATCGACGCGCGC
GTCGCGGAGCTCGATCGGCTGATCTCGGCGCAACTGTCCGCGGTGATGCACGCGCCGGAATTCCAGCGCC
TCGAAAGCACGTGGCGCGGGCTCGACTATCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCACCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCCAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGCGCGCTGATCGGCG
ACTACGAGATCTCGCGTCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCGGCCGC
GCACGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAATCGTTCGCCGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAAACCTTCAACTTCGTCGAAGACGTCGACGGCACCGACCACGACAAGTATCTGTGGTGCAAC
GCCGCGTGGGCATTCGCCGCGCGGCTGACGGCCGCATTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAGGGCGGCGGGCTCGTCGAGGATCTGCCGACGCACACCTTCAAGACCGACGACGGCGAAGTCGC
GCTGAAGTGCCCGACCGAGATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGATCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAATTCTGATTACGCCGCGTTCTTCGCTGCGCAATCGGTGCAGAAACCGAAAA
AATACAGCACCGACAGCGCGAACGCGAACGCCGTACTCTCTGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTTGCGCATTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCGTCGGCGCAGAACGTG
GAGACCTTCCTCAACCGGTGGATTTCGCAATACGTGCTGCTCGACGACAACGCGACGCAGGAGCAGAAGG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTATCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCATTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA
 Primer design