SecReT6
Protein ID: 189349189
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00306
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]320322..320825 [+]
Producthypothetical protein
NoteTssD
UniProt IDA9AK63
KEGG IDbmj:BMULJ_00306, bmu:Bmul_2928
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-44, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|189349189|ref|YP_001944817.1| hypothetical protein BMULJ_00306 [Burkholderia multivorans ATCC 17616]
MLHMHMQFGSPAIKGESADKDHQGWIELKSWDHSIIQPRSATASTAGGHTATRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTIHFSRADGEGKRVQYLEIKLKYVIISSIAPSVREEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|189348893|ref|NC_010804.1|:320322-320825 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGTTACACATGCACATGCAGTTTGGTAGTCCGGCGATCAAAGGCGAATCCGCGGACAAGGACCACCAGG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCATCCAGCCGCGTTCGGCGACCGCGTCGACCGCAGG
CGGCCACACCGCCACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACGACGTTCGACGAAGTGACGATTCATTTCTCGCGTGCGGACG
GCGAAGGCAAGCGTGTCCAGTATCTGGAAATCAAGCTCAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCGCGAGGAAGGCCTGCCGGTCGAGACGTTCTCGCTGAAGTATGCGGCCGTGCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design