SecReT6
Protein ID: 189349190
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00307
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]320888..321373 [+]
Producthypothetical protein
NoteTssE
UniProt IDA9AK62
KEGG IDbmj:BMULJ_00307, bmu:Bmul_2927
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|189349190|ref|YP_001944818.1| hypothetical protein BMULJ_00307 [Burkholderia multivorans ATCC 17616]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTETELATLPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARTARML
 
Nucleotide Sequence: 486 bp     [Download]
>gi|189348893|ref|NC_010804.1|:320888-321373 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAAACGCTTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCCTCGGCCG
CGATGCGGCAATTGTCGCTGGACGAGCTGAAGAACACGGTCGCCCGCGACGTCGAGGCGATTCTCAATAC
CCGTATCGCACACACCGAAACCGAGCTGGCCACGCTGCCGGAATGCCAGAAGTCGGTGCTGACTTACGGG
CTCAACGATTTCGCGGGGCTGAGCCTCGCCAGCCACTACGATCGCGCATTCATCTGCAAGTCGATCCAGC
AGGCGATCGCACGCCACGAGCCGCGGCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTCTACTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCGGCCGAAGAGCCGGTCAGCTTCGAC
GCGATGCTGCAGCCTTCGACGCTCCAGTATTCGGTCACGCGCGCGCGCACTGCACGCATGCTGTAA
 Primer design