SecReT6
Protein ID: 189349191
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00308
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]321452..323287 [+]
Producthypothetical protein
NoteTssF
UniProt IDA9AK61
KEGG IDbmj:BMULJ_00308, bmu:Bmul_2926
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-214, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|189349191|ref|YP_001944819.1| hypothetical protein BMULJ_00308 [Burkholderia multivorans ATCC 17616]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFAAAAPGQQTEPVVIRRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYTPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLPTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRQLPIAQAGFDEDDALIDYPAKSHPAYRLLTEYFGFPDKFDFVDFDIAAIARASGRC
QRATLHLVLQDVRSDSHVARLLELLAASHFRLFCTPVVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGEAARIGHYWFARRNDSVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPAMLAFGLEGGDLFQDGGAQTAGIALLRRPTQTVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSTRQIDGLVAIEQRGAVQWLPGKPFATFVRGIEVRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|189348893|ref|NC_010804.1|:321452-323287 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTACTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCGGGATTTCGCCG
AACGCTATCCGAAGATCGCGGCGCGCCTCGCGCTGTCCGGCGAGCATTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGACTACCCGGAATTC
ACCGAAGCGCTGCTCGAAGTGCTGTATCCGCACTATCTGCGGCCGTTTCCGTCGTGCTCGATCGCGCAGT
TCGCGGCGGCGGCGCCCGGGCAGCAGACGGAGCCGGTCGTGATCCGGCGCGGCACCGAACTGAAGAGCCG
CCCGATCCGCGGCGTGCAGTGCCGGTTCCGCACCGCCTACGACGTGACGCTCGCGCCGATCCGCATTTCG
GAGGCGCGCTATACGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCGAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCACTGAAGCTGCCGACGCTGCGCGC
GCATCTGCACGGCGAGCAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTGGGCGCG
TACGTCGAACCCGAGCGCAACGGCCGCTGGACCGCGCTGCGCCAGTTGCCGATCGCGCAGGCCGGCTTCG
ACGAAGACGATGCGCTGATCGACTATCCGGCGAAATCGCATCCCGCCTATCGTCTGCTGACCGAATACTT
CGGCTTTCCCGACAAGTTCGACTTCGTCGATTTCGACATCGCCGCGATCGCGCGCGCATCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCATGTCGCGCGGCTGCTCGAGC
TGCTCGCCGCGAGCCACTTCCGCTTGTTCTGCACGCCGGTCGTCAACCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCATCGTGCGGTGTCGTATCCGGTGATCGCCGAAGCGCGCCGCGCCTTCGCGTACGAG
GTCTATTCGATCGATTCGGTGAAGCTCGTGCGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAAGCGGCGCGGATCGGCCATTACTGGTTCGCGCGCCGCAACGACTC
GGTCGCGCAGAAGAGCCCCGGCTACGAGACCGAGATCTCGATCGTCGACATCGATTTCGAGCCCACTTCA
CCGCAGACCGACACGCTGAGCCTCGATCTCACCTGCACGAACCGCGACCTGCCGGCGATGCTCGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGACGGCGGCGCGCAGACGGCCGGGATCGCGCTGCTGCGCCGTCC
GACGCAGACGGTACGCTTCGAGCGCGGCCGCGCCGCGCACTGGCGTCTCGTGTCGCATCTCGCGCTGAAC
CACGTGTCGCTCGTCGCGCACGGGCTCGCGCCGCTCAAGGAGATGCTGACGCTGTACGATCTGCGGCGCA
CGGCGGTGTCGACGCGCCAGATCGACGGGCTCGTCGCGATCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAACCGTTCGCGACCTTCGTGCGCGGAATCGAAGTGCGGCTGACGATCGACGAAGAGCATTTCGTC
GGCGCGAGCCTCGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTACGTGCACCTCAACAGCT
TTGTTCAACTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGCACCGGCGA
ATCGATTCTGGCGTAG
 Primer design