SecReT6
Protein ID: 189349192
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00309
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]323251..324351 [+]
Producthypothetical protein
NoteTssG
UniProt IDA9AK60
KEGG IDbmj:BMULJ_00309, bmu:Bmul_2925
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|189349192|ref|YP_001944820.1| hypothetical protein BMULJ_00309 [Burkholderia multivorans ATCC 17616]
MQAPHRRIDSGVVDTLLDEPHRFEFFQAVRVLEGLFARQAADAPGAWRQGDVVAHRIAFRNTLSLGFPPS
EIEGARSFDDDGLPLDSAEQREAAVAGGELGRVELTPAFFGLLGAQGALPLHYTEQIAAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDDVRDSLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGQVNAVLGATALVGERVWQRDMRAR
IVIGPLSKRDYEAFLPGGAQAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
ADEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|189348893|ref|NC_010804.1|:323251-324351 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGCAAGCCCCGCACCGGCGAATCGATTCTGGCGTAGTCGATACGCTGCTCGACGAACCGCACCGCTTCG
AATTCTTCCAGGCGGTACGCGTGCTCGAAGGGCTGTTCGCGCGGCAGGCCGCCGATGCGCCCGGCGCGTG
GCGGCAAGGCGACGTCGTCGCGCACCGGATCGCGTTCCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAAGGCGCCCGCTCGTTCGACGACGACGGCCTGCCGCTCGACTCGGCCGAGCAGCGCGAAGCGG
CGGTCGCGGGCGGCGAGCTCGGGCGCGTCGAACTGACGCCGGCGTTCTTCGGGCTGCTCGGCGCGCAGGG
CGCGCTGCCGCTGCACTACACGGAACAGATCGCGGCGCGCGAGCATCTGAAGCGCGACCATGCGGCGCGC
GCATTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTACGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCACTACGAGCTCGATCGCGACGAGCGCTATCTGCCGCTGCTGCTCGCGATCGCGGGCGTGCCGAG
CGACGACGTGCGCGACAGTCTCGCGGCAGGCGCGGGCGGCGTGCTCGACGAAGCTGTCGCCGGCTATGCG
CTCGCCGCGCGGCACCGGCCGATGTCGGCTGCCTATCTGCAGCGCACGCTGTCCGACTATTTCCGCGTGC
CGGTGAAGATCGATCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAGCTGAGCGTGCTCGGCCA
GGTCAACGCGGTGCTCGGCGCGACGGCGCTGGTCGGCGAACGCGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTGATCGGCCCGCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCGGGCGGCGCGCAGGCCGTTGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAAGTGAAGCTCGTGCTGAAGCGGAC
CGAAGTCGGCGCGAGCGTACTCGGCGCCGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCCGACGAAGACCGGTCCGACGCGCGCTACGAGCTGCACGTGATTCACTGA
 Primer design