SecReT6
Protein ID: 189349193
SecReT6 ID288
T6SS typei4b
Gene symbolclpB
Locus tagBMULJ_00310
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]324396..327065 [+]
Productprotease associated ATPase
NoteTssH
UniProt IDA9AK59
KEGG IDbmj:BMULJ_00310, bmu:Bmul_2924
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-43, Aligned region: 232..314
AAA_2 [PF07724], Evalue: 1.50E-43, Aligned region: 619..787
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 232..345
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 624..741
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 318..362
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 623..743
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 794..869
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 17..77
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 209..257
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 471..539
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 594..662
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 689..711
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 785..829
Clp_N [PF02861], Evalue: 7.10E-09, Aligned region: 23..74
Clp_N [PF02861], Evalue: 7.10E-09, Aligned region: 113..133
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 349..391
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 620..644
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 5.70E-06, Aligned region: 214..247
Sigma54_activat [PF00158], Evalue: 5.70E-06, Aligned region: 600..740
AAA_17 [PF13207], Evalue: 8.40E-05, Aligned region: 35..105
AAA_17 [PF13207], Evalue: 8.40E-05, Aligned region: 233..281
AAA_17 [PF13207], Evalue: 8.40E-05, Aligned region: 623..658
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 216..252
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 623..641
AAA_25 [PF13481], Evalue: 0.00029, Aligned region: 232..255
AAA_25 [PF13481], Evalue: 0.00029, Aligned region: 288..327
AAA_25 [PF13481], Evalue: 0.00029, Aligned region: 618..641
AAA_19 [PF13245], Evalue: 0.00043, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00043, Aligned region: 620..645
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 284..370
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 621..660
Arch_ATPase [PF01637], Evalue: 0.00063, Aligned region: 694..717
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00079, Aligned region: 619..648
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 234..258
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 468..537
AAA_18 [PF13238], Evalue: 0.00088, Aligned region: 625..648
AAA_14 [PF13173], Evalue: 0.00096, Aligned region: 233..366
AAA_14 [PF13173], Evalue: 0.00096, Aligned region: 622..704
NACHT [PF05729], Evalue: 0.001, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.001, Aligned region: 387..461
NACHT [PF05729], Evalue: 0.001, Aligned region: 624..644
SRP54 [PF00448], Evalue: 0.0015, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0015, Aligned region: 622..655
Zeta_toxin [PF06414], Evalue: 0.0018, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.0018, Aligned region: 614..663
MobB [PF03205], Evalue: 0.0034, Aligned region: 233..256
MobB [PF03205], Evalue: 0.0034, Aligned region: 622..655
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 624..645
Protein Sequence: 889 a.a.     [Download]
>gi|189349193|ref|YP_001944821.1| protease associated ATPase [Burkholderia multivorans ATCC 17616]
MSTPLKTLITKLNPLCRHAAERAASACLARGHYEVDLEHLFLALLEEPAGDLSLALRASRIDAHALRADL
ERELTRLKTGNTRTPVFSVHLIALFEQAWLIASLDSQLGRIRSGHLLLALLTAPDLAQFAQRMSARFSEV
NVTDLKHKFDEITAGSSEAEPHRADAEHGDAAAPAEGGAPAAGASKTPALDTYTTNLTQRARDGKIDPVI
GREAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSESLAAAMLRGMAGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSATPAAIDDTKKRTERIDAEIASLERDAASGAAHDERLGELRGARDAALEQLAKDE
ARYEAERAIVAEITALRETLDRARAPADDGQPVDVQATREKLAERVAALHALQGGEPMVPLQVDGHVVAE
IVAAWTGIPLGRMVKDEIGTVLNLKPLLAARVIGQDHALEAIAQRVRTASANLEDPNKPRGVFMFVGPSG
VGKTETALALADILYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGMMDDAEGREIDFRNTLIILTSNVGSAAVMQACLNKPAEELPDPDALAEALR
PQLYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRSRIEANHKAAFEWDESLVEAVLARCTEVDS
GARNVDHILNGTLLPEIAGHVLGRIADGASIARIAVRADDAGEFAYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|189348893|ref|NC_010804.1|:324396-327065 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAGCACGCCTCTGAAGACCCTCATCACGAAACTGAATCCGCTGTGCCGGCATGCGGCCGAGCGTGCGG
CGAGCGCGTGTCTCGCGCGCGGCCATTACGAGGTCGATCTGGAGCATCTGTTTCTCGCGCTGCTCGAGGA
GCCGGCGGGCGACCTGTCGCTCGCACTGCGCGCAAGCCGCATCGACGCGCATGCGTTGCGCGCCGATCTC
GAGCGCGAGCTCACGCGCCTGAAGACCGGCAACACGCGCACGCCCGTATTCTCCGTGCATCTGATCGCGC
TGTTCGAGCAGGCGTGGCTGATCGCGTCGCTCGACTCGCAGCTCGGCCGCATCCGCTCGGGCCACCTGCT
GCTCGCGCTGCTCACGGCGCCGGACCTCGCGCAGTTCGCGCAGCGGATGTCGGCGCGCTTTTCCGAAGTG
AACGTGACCGATCTGAAGCACAAGTTCGACGAGATCACGGCCGGGTCCAGCGAAGCCGAGCCGCATCGTG
CGGACGCGGAGCACGGCGACGCCGCTGCGCCGGCCGAGGGCGGCGCGCCGGCAGCGGGCGCATCGAAGAC
GCCCGCGCTCGACACGTACACGACGAACCTCACACAGCGTGCACGCGACGGGAAGATCGACCCGGTGATC
GGCCGCGAAGCCGAGATCCGTCAGGCGATCGACATCCTGATGCGGCGCCGCCAGAACAATCCGATCATGA
CGGGCGAGGCCGGCGTCGGCAAAACGGCCGTCGTCGAAGGGCTCGCGCTGCGCATCGCAGCCGACGACGT
GCCGCCGCCGCTGCGCGGCGTCGCGCTGCACGTGCTCGACATGGGGCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGTCTGAAGAGCGTGATCGACGAGGTCAAGAAGAGCCCGCATCCGATCATCC
TGTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGACAGGCCGGCCAGAACGACGCGGCGAACCT
GCTGAAGCCCGCGCTTGCGCGCGGCGAGCTGCGCACGATCGCGGCGACGACGTGGAGCGAATACAAGAAG
TACTTCGAGAAGGATGCCGCGCTCGCGCGACGCTTCCAGGTGGTGAAGGTCGAGGAACCGAGCGAGTCGC
TGGCGGCCGCGATGCTGCGCGGCATGGCCGGACTGATGGAGAAGCACTTCAACGTGCGGATTCTCGACGA
CGCGATCACCGAGGCCGTCCGGCTCTCGCATCGCTATATCAGCGGGCGGCAACTGCCGGACAAGGCGATC
AGCGTGCTCGACACCGCGTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCGGCCGCGATCGACGACA
CGAAAAAGCGCACCGAGCGCATCGACGCGGAAATCGCGTCGCTCGAGCGTGATGCGGCAAGCGGCGCGGC
GCACGACGAACGACTCGGCGAGCTGCGCGGCGCGCGCGACGCGGCGCTCGAACAGCTCGCGAAGGACGAA
GCGCGCTACGAGGCGGAACGTGCGATCGTCGCCGAGATCACCGCGCTGCGCGAGACGCTCGATCGCGCCC
GCGCGCCGGCCGACGACGGCCAGCCGGTCGACGTGCAGGCCACGCGCGAGAAGCTCGCCGAACGCGTCGC
GGCGCTGCATGCACTGCAGGGCGGCGAGCCGATGGTGCCGCTGCAGGTCGACGGTCACGTGGTGGCCGAG
ATCGTCGCTGCGTGGACCGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGGCACCGTGCTCAATC
TGAAGCCGCTGCTCGCCGCGCGCGTGATCGGCCAGGACCATGCGCTCGAAGCGATCGCGCAACGCGTGCG
CACCGCGTCGGCGAACCTCGAGGATCCGAACAAGCCGCGTGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGTAAGACCGAGACGGCGCTGGCGCTCGCGGACATCCTCTACGGCGGCGAGCGCAAGATGATCACGA
TCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCCGGCCTGAAGGGTTCGCCGCCGGGCTACGTCGG
TTACGGCGAAGGCGGCGTGCTGACCGAGGCTGTGCGGCGCAATCCGTATTCGGTCGTGCTGCTCGACGAG
GTCGAGAAAGCGCATCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCATGATGGACGACG
CCGAAGGGCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACGTCGAACGTCGGTTCGGCCGCGGT
GATGCAGGCGTGCCTGAACAAGCCGGCCGAGGAACTGCCCGATCCCGATGCGCTCGCGGAAGCGCTGCGC
CCGCAGCTGTACAAGGCGTTCAAGCCCGCTTTCCTCGGCCGGATGAAGGTGGTGCCGTACTACCCGATCT
CCGACGACGTGCTCGCCGAGATCATCGAGCTGAAGCTCGAACGGATTCGCAGCCGCATCGAGGCGAACCA
CAAGGCCGCGTTCGAATGGGACGAATCGCTCGTCGAAGCGGTCCTCGCGCGCTGTACCGAAGTCGACTCG
GGCGCACGCAACGTCGACCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCGGGCCACGTGCTGGGCC
GGATCGCCGACGGCGCGTCGATTGCGCGCATCGCGGTGCGCGCGGACGACGCCGGCGAGTTCGCATACAC
GGTCGAATGA
 Primer design