SecReT6
Protein ID: 189349194
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00311
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]327104..328225 [+]
Producthypothetical protein
NoteTssA
UniProt IDA9AK58
KEGG IDbmj:BMULJ_00311, bmu:Bmul_2923
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.10E-25, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|189349194|ref|YP_001944822.1| hypothetical protein BMULJ_00311 [Burkholderia multivorans ATCC 17616]
MPINLPELLTPISDASPTGDDLLFSNEFDAIQEARRYDDPTLDQGEWVTEIKEADWGLVVERATDLLRTR
TKDLRVAVWLTEALALEDGITGLTEGYALLEGLCREYWDTVHPLPEGEDVEYRLGNVAWLAGRTAELLRG
IPMTDGAANAFTTLDWEVAQHVAQAIKRDPEHADDIARGKPSVEQIDASRRVTPIAFYATLLANLKAFEF
ALDAFEDTLVARAGDAAPSFRQTRDAFETVYRLAERFAREQGYTGSAPHKEAAPAAQPERIEPSFGTPIQ
TEETHVQSQTAPRPPVTQTIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|189348893|ref|NC_010804.1|:327104-328225 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGCCGATCAATCTGCCCGAGCTGCTGACGCCGATCAGCGACGCGTCGCCCACCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGAGGCGCGGCGCTACGACGATCCGACGCTCGATCAAGGCGAGTG
GGTGACCGAGATCAAGGAGGCCGACTGGGGCCTCGTCGTCGAGCGCGCGACCGACCTGCTGCGCACGCGC
ACGAAGGATCTGCGCGTCGCGGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGTCTCA
CCGAAGGCTATGCGCTGCTCGAAGGACTGTGCCGCGAGTATTGGGACACCGTTCATCCGCTGCCCGAAGG
CGAGGACGTCGAATACCGGCTCGGCAACGTCGCATGGCTGGCCGGCCGCACGGCCGAGCTGCTGCGCGGC
ATACCGATGACGGACGGCGCGGCGAACGCGTTCACGACGCTCGACTGGGAGGTCGCGCAGCACGTGGCGC
AGGCGATCAAGCGCGATCCCGAGCATGCGGACGACATCGCGCGCGGCAAGCCGTCGGTCGAGCAGATCGA
TGCATCGCGGCGCGTGACGCCGATCGCGTTCTATGCGACGTTGCTCGCGAACCTGAAGGCATTCGAGTTC
GCGCTCGATGCGTTCGAGGACACGCTGGTCGCGCGCGCGGGCGATGCCGCGCCGAGTTTCCGGCAGACGC
GCGACGCGTTCGAGACCGTGTATCGGCTTGCCGAGCGCTTTGCGCGCGAGCAGGGCTATACCGGCAGCGC
GCCGCACAAGGAGGCGGCGCCCGCCGCGCAGCCCGAGCGCATCGAGCCGAGTTTCGGCACGCCGATTCAG
ACCGAGGAGACCCACGTGCAGTCGCAAACCGCTCCGCGTCCGCCGGTGACGCAGACGATCGCCGGCATCC
AGAACCGTGCGCAGGCCGTCGATCAGTTGCGTGCGGTCGCGCGTTACTTCCGTCAGACGGAGCCGCATAG
CCCGGTCGCCTATCTCGCCGACAAGGCGGCGGAATGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTCAAGGATGACGGATCGCTGTCGCATATTCGCGAGCTGCTGGGGGTGAGGCCGGACGAGCAGTCGT
GA
 Primer design