SecReT6
Protein ID: 189349207
SecReT6 ID288
T6SS typei4b
Gene symbol-
Locus tagBMULJ_00324
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010804] [Browse all T6SS(s) in this replicon]
Location [Strand]345127..346077 [-]
ProductOOP family OmpA-OmpF porin
NoteTagL
UniProt IDA9AJ89
KEGG IDbmj:BMULJ_00324, bmu:Bmul_2909
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.70E-26, Aligned region: 11..27
OmpA [PF00691], Evalue: 2.70E-26, Aligned region: 154..173
OmpA [PF00691], Evalue: 2.70E-26, Aligned region: 214..308
BON [PF04972], Evalue: 5.60E-06, Aligned region: 88..125
BON [PF04972], Evalue: 5.60E-06, Aligned region: 161..183
Protein Sequence: 316 a.a.     [Download]
>gi|189349207|ref|YP_001944835.1| OOP family OmpA-OmpF porin [Burkholderia multivorans ATCC 17616]
MQRTNHALRARRCAVVAALVAAGFVASGAAYAQNAGGATVTPVGNGTVAASALPANAGAGSASAAASATL
VRGTAGTLAPPPANAAPGQVVVGGKVPDEATKAAVLQKLRDTYGAANVVDQIEVGDVATPPNWSANVQKL
LGTQLKQISKGQLKINGTQIEMKGEVHNEAQRQQIASDMANTLNPTYTIKNGLRVSASEQGLLDQTLANR
TIEFETGSATLTPQGKQILDQMAAALAKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKGIA
PQQMTTTGVGPDQPIAPNDTAEGRARNRRIEFRVGQ
 
Nucleotide Sequence: 951 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c346077-345127 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGCAACGGACGAATCACGCACTGCGCGCGCGCCGCTGCGCTGTCGTCGCCGCGCTGGTCGCGGCCGGCT
TCGTCGCCAGCGGTGCGGCATACGCGCAGAACGCCGGCGGCGCGACCGTCACGCCGGTCGGCAACGGCAC
CGTCGCGGCGAGTGCGCTGCCGGCGAATGCCGGCGCCGGTTCGGCGAGCGCGGCCGCATCCGCCACGCTC
GTGCGCGGCACGGCCGGCACGCTCGCGCCGCCGCCCGCGAATGCGGCGCCCGGCCAGGTGGTCGTCGGCG
GCAAGGTGCCCGACGAGGCGACCAAGGCCGCCGTGCTGCAGAAGCTGCGCGACACGTACGGCGCCGCGAA
CGTCGTCGATCAGATCGAGGTCGGCGACGTCGCGACGCCGCCCAACTGGAGCGCGAACGTGCAGAAGCTG
CTCGGTACGCAGCTCAAGCAGATCAGCAAGGGGCAGCTGAAGATCAACGGCACGCAGATCGAGATGAAGG
GCGAGGTGCACAACGAGGCGCAGCGCCAGCAGATCGCGAGCGACATGGCCAATACGCTGAACCCGACGTA
TACGATCAAGAACGGGCTGCGCGTGTCGGCGTCCGAGCAGGGGCTGCTCGATCAGACGCTCGCGAACCGG
ACGATCGAGTTCGAGACCGGCAGCGCGACGCTGACGCCGCAGGGCAAGCAGATTCTCGACCAGATGGCGG
CCGCGCTCGCGAAGCTGCAGAACCGGACCGTCGACATCATCGGGCATACCGACAACTCGGGGAATCGAAC
GTCGAACATCGCGCTGAGCCAGGCTCGGGCGGATGCGGTGAAGGGATATCTGATCACGAAAGGGATCGCG
CCGCAGCAGATGACGACGACGGGAGTCGGGCCGGATCAGCCGATCGCGCCGAATGATACGGCCGAGGGGC
GGGCGAGGAATCGGCGGATCGAGTTCAGGGTGGGGCAGTAG
 Primer design