SecReT6
Protein ID: 190894193
SecReT6 ID290
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PB0000227
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T6SS(s) in this replicon]
Location [Strand]241890..245495 [+]
Producthypothetical protein
NoteTssM
UniProt IDB3Q2N1
KEGG IDrec:RHECIAT_PB0000227
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-88, Aligned region: 214..476
IcmF-related [PF06761], Evalue: 1.10E-72, Aligned region: 527..827
DUF1215 [PF06744], Evalue: 7.80E-31, Aligned region: 942..1063
Protein Sequence: 1201 a.a.     [Download]
>gi|190894193|ref|YP_001984487.1| hypothetical protein RHECIAT_PB0000227 [Rhizobium etli CIAT 652]
MQSIKKALRWQWLRVGGAAIVCALIFTLGPHISVGGFAPLDSLRSQIAASMLIPVGYTVIYLIQSQLYKV
QAYFEDLVQSRVSGALDAGGAEQKKGDPRPSDRSVGQASTLAERELEAIRHRFRETLTTLKGRRYAGGIS
RRWLYQRPWYVMIGPPNSGKTTAIVNSGLSFPMAARSGLRAAGGLAGTENCDWWITDDAVFVDTAGRYTV
QEGDADRDKAVWRGLLRMLRRSRPRQPLNGVLVTIAISELNSTSEEVLADRARCIRERLLEVYRELRLQL
PIYVLFTKSDLLAGFVEFFDDLGREGREAVWGFTFAQEASEDEGDPMAFAAAYDALVGRLNERLLERMQH
ESNLQRRALMFGFPQQVASLKHLTQQFLKEAFGGNSFQEPLMLRGVYFLSGTQIGMPFDRVANARSQTFE
IAQPPCTALRGPGRNYFISRLLREVVFAEAGLVDANHRFDRRQRRIRYGAYTMIAAVIVTASVLWTFSYI
RNVQLIESVRLMAGSYARGAEKLKLDRVESGDLRPILPLLQRLRDANGDSAGGRLSSSGLDQSKKIKVQT
LAAYRRAVNTILLPRLMFRLETLLVERHDDDQFVYQALKVYLMLGQQGPLQRAVVKNWMAADWRVMFPAE
ADAGLRSALADHLDALMEGPLPHSELNGELIERSRAKLQTVSMARRVLDIIATSPEASRAPTWRLADHAG
PLAQGVLARKSGQPLSEGVPGIYTRAGFYGTFLRLLPQVADAVAAEGWVLDSQVVAPIAAGDVSQKLRRS
AADLYAQEFALRWDQLIGDMSIRPSGGIDDALRTLNTLSAPTSPMRLFLFAAAQELKLKQPPAPEDGLTK
GDSVPQGEVLPSELEALFRSQPAADTPEAHVQLYMGDHFRWLHQLVEVPSNSQAGAQAPIDSALRDLGEL
YRSLSQAQGLAGSNILEHNGQAGVAIQQIEAGAADLPEPIRQWILGLSRHSSDLTVSGMRRGLASGWAGG
PGDLCRRATEGRYPFASGSRRDIPLSDFARLFGRKAEIDTFFAENLSPFVDKSKGSWQFRPTSGVDFPIG
RNTLAQFQRAATIRDTMFDDAGQVSVGFLLTVAETDPLTDQVVVDIDGQRLEHRRGTAAAAMHFHWPTAG
GVGGASVAFIGFQGATLSKSGHWALFRLLNEADKQPLGGGDLIQVRLVSGRHWAVFNLQPDSVMSPLSRN
LLSEFRCPDFL
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|190893983|ref|NC_010996.1|:241890-245495 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGCAGTCAATCAAGAAAGCGCTTAGGTGGCAATGGCTCCGTGTCGGCGGGGCGGCGATCGTATGTGCCT
TAATCTTCACGCTCGGACCGCATATCTCGGTCGGAGGATTTGCGCCGCTTGACAGCCTTCGCAGCCAGAT
CGCGGCATCGATGCTGATTCCGGTCGGATACACCGTGATCTACTTGATCCAGTCCCAGCTTTACAAGGTT
CAGGCCTATTTTGAAGACCTCGTCCAATCACGAGTGTCGGGAGCGCTGGACGCGGGTGGGGCCGAGCAGA
AGAAGGGAGACCCAAGGCCTTCCGACCGAAGTGTGGGGCAAGCCAGCACGCTTGCTGAAAGAGAGCTGGA
GGCGATTCGTCATCGTTTCCGCGAGACCCTTACCACACTCAAGGGGCGCCGCTACGCAGGAGGTATCAGC
AGGCGGTGGCTCTATCAGCGGCCCTGGTATGTGATGATCGGTCCGCCCAACTCGGGGAAGACCACAGCAA
TAGTCAATTCCGGGCTCAGCTTTCCGATGGCGGCGAGGTCCGGTCTGAGAGCCGCCGGTGGGTTAGCGGG
TACGGAAAACTGCGACTGGTGGATCACCGATGACGCGGTGTTCGTCGACACTGCTGGGCGCTACACGGTA
CAGGAGGGTGATGCAGACCGGGACAAAGCGGTTTGGCGTGGCTTGCTTCGTATGCTCAGACGCTCCCGGC
CACGGCAGCCGCTGAACGGTGTCTTAGTCACGATCGCAATCAGCGAGCTGAATTCTACATCCGAGGAAGT
GCTCGCCGATCGCGCGCGCTGTATCCGTGAGCGGCTCCTCGAAGTGTACAGGGAGCTTCGCCTGCAACTG
CCGATTTATGTGCTTTTCACTAAGAGCGATCTGCTGGCGGGATTTGTTGAATTCTTCGACGATCTGGGTC
GCGAGGGGCGGGAGGCGGTGTGGGGGTTCACCTTTGCGCAAGAGGCGTCGGAGGACGAAGGCGATCCGAT
GGCGTTTGCCGCAGCATACGATGCGCTTGTTGGCCGCCTAAACGAAAGGCTGCTTGAACGAATGCAGCAC
GAAAGCAACCTCCAGCGTCGTGCGCTCATGTTCGGCTTCCCACAGCAGGTCGCTAGCCTCAAGCACCTGA
CGCAACAGTTCTTGAAGGAAGCCTTTGGCGGGAATTCGTTCCAGGAACCGCTTATGCTCCGCGGCGTCTA
CTTCTTAAGCGGCACGCAAATTGGCATGCCCTTCGATCGAGTTGCGAACGCCAGATCTCAGACCTTCGAG
ATCGCTCAGCCGCCCTGTACAGCGCTTCGTGGCCCGGGCCGTAATTATTTCATCAGCCGGCTGCTGCGCG
AAGTCGTTTTCGCCGAAGCTGGGCTCGTCGATGCCAATCACCGCTTCGATCGGCGCCAGCGGCGGATCCG
GTATGGCGCCTACACGATGATAGCGGCGGTCATTGTTACCGCCAGCGTCTTATGGACGTTCAGCTATATT
CGGAATGTTCAGCTGATCGAGAGCGTTCGCCTAATGGCTGGCAGCTATGCCAGAGGGGCTGAAAAGCTGA
AGCTCGACCGGGTTGAGAGTGGCGATCTTCGACCCATCCTGCCACTGCTTCAGCGGCTGCGTGATGCCAA
CGGCGACAGCGCGGGCGGCCGCCTATCAAGTTCGGGTCTCGACCAAAGTAAGAAAATCAAGGTTCAGACG
CTCGCGGCGTACCGCCGCGCCGTGAACACCATCCTGCTGCCGCGGCTGATGTTCCGGTTGGAAACCTTAT
TGGTCGAGCGGCACGACGATGATCAGTTCGTCTACCAGGCGTTAAAGGTTTACCTGATGCTGGGTCAGCA
GGGTCCGCTCCAGCGCGCGGTCGTCAAAAACTGGATGGCTGCCGACTGGCGAGTGATGTTTCCGGCCGAA
GCCGATGCCGGCCTGCGCAGCGCGCTCGCTGATCACCTGGATGCACTCATGGAAGGGCCGCTGCCCCATA
GTGAGCTTAATGGCGAACTGATCGAGAGGAGCCGCGCGAAGCTCCAGACCGTCTCGATGGCGCGCCGCGT
CCTCGACATCATCGCGACCAGTCCCGAAGCCTCGCGGGCGCCAACCTGGCGTCTGGCCGACCATGCCGGG
CCGCTGGCGCAGGGCGTCCTGGCTCGCAAATCGGGACAGCCGCTCAGCGAGGGGGTTCCTGGCATCTACA
CGAGGGCGGGGTTTTACGGAACCTTCCTGCGATTGCTGCCGCAAGTGGCTGACGCTGTCGCTGCAGAAGG
CTGGGTTCTCGACTCACAGGTAGTCGCGCCGATTGCAGCCGGTGATGTGAGCCAGAAGCTGCGGCGTTCG
GCGGCGGATCTCTACGCTCAGGAGTTCGCGTTGCGCTGGGACCAGCTCATTGGCGATATGTCCATCCGCC
CGTCTGGGGGTATCGATGACGCGCTGCGCACCTTGAACACGCTGTCCGCGCCGACGTCACCAATGCGCCT
GTTCCTTTTCGCGGCGGCGCAGGAGCTAAAGCTCAAGCAACCACCGGCTCCCGAGGACGGCTTGACGAAA
GGTGACAGTGTCCCCCAGGGCGAGGTGTTGCCAAGCGAGCTCGAGGCACTGTTCCGGTCTCAACCGGCCG
CGGACACGCCTGAAGCTCACGTCCAGCTCTATATGGGCGATCATTTCCGGTGGCTGCACCAGCTGGTCGA
AGTGCCGTCGAACAGCCAAGCGGGCGCGCAGGCGCCGATCGACAGTGCTCTCCGGGATCTCGGCGAACTG
TATCGCTCCCTCAGCCAGGCGCAGGGGCTGGCGGGTTCGAACATCTTGGAACACAACGGGCAGGCGGGCG
TCGCCATCCAACAGATCGAGGCGGGGGCGGCCGATCTGCCCGAACCCATCCGGCAATGGATCCTCGGCCT
CAGCCGCCACAGCTCGGACCTAACCGTCAGCGGCATGAGGCGCGGGTTGGCGAGCGGTTGGGCGGGCGGC
CCCGGCGATTTGTGCCGACGGGCTACCGAAGGACGGTATCCCTTCGCGAGCGGATCCCGCCGGGATATCC
CTTTGAGCGATTTCGCCCGGCTGTTCGGCCGCAAGGCGGAGATCGACACTTTCTTCGCCGAGAACCTTTC
CCCATTCGTCGACAAATCCAAAGGTTCGTGGCAGTTTCGGCCAACGAGCGGTGTCGATTTCCCTATCGGC
CGCAATACCTTGGCCCAGTTCCAACGGGCAGCCACGATCCGCGACACCATGTTCGATGATGCCGGCCAGG
TGTCAGTTGGATTCCTGCTCACCGTCGCCGAGACCGATCCGTTGACAGACCAGGTGGTGGTAGACATCGA
CGGCCAGCGCCTCGAACATCGACGAGGAACGGCCGCCGCGGCCATGCATTTCCATTGGCCTACGGCCGGC
GGCGTCGGCGGCGCTTCCGTCGCTTTCATCGGTTTTCAAGGCGCCACCCTCTCCAAGAGCGGCCATTGGG
CGCTGTTTCGCCTCTTAAATGAGGCGGATAAGCAGCCATTGGGAGGAGGGGACCTTATTCAGGTACGACT
GGTGTCCGGTCGCCATTGGGCGGTTTTTAACCTCCAGCCTGACAGCGTGATGAGCCCGTTGTCCCGCAAT
CTGCTGTCAGAATTCCGATGTCCAGATTTCTTATGA
 Primer design