SecReT6
Protein ID: 190895260
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000933
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1022721..1025150 [-]
Producthypothetical protein
NoteTssM
UniProt IDB3Q3Z3
KEGG IDrec:RHECIAT_PC0000933
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.40E-26, Aligned region: 30..88
IcmF-related [PF06761], Evalue: 1.40E-26, Aligned region: 229..480
DUF1215 [PF06744], Evalue: 4.80E-20, Aligned region: 593..674
DUF2077 [PF09850], Evalue: 8.30E-05, Aligned region: 6..123
DUF2077 [PF09850], Evalue: 8.30E-05, Aligned region: 131..162
Protein Sequence: 809 a.a.     [Download]
>gi|190895260|ref|YP_001985553.1| hypothetical protein RHECIAT_PC0000933 [Rhizobium etli CIAT 652]
MQADVLAALAQPLLDLARRAESEKNPDPRELAAMARTLVAAFETEARRRKVPPDWLLDARDALVALVDAR
ARNNPALPIRKWERALAAALPIGGVMAASTLAERARAAAKAGPARRDLARFLGHCNDAVQAALLSRTQHK
TDRGLAAPVIGIFLAVLVVWAGWAEWRFRERLLSQLPDVARVVEAGRTAKPAARAAQLDAFLAGVRLVET
DAQRSPLGLIHHLRIFDPAEAARRRYGQAVDALASGPLADALGVALATEGEATALYDSLRAWSILKGTSD
WQPRFLAGWIEDRTQTFPELAGMAMHVAAMSGPPADLEEPDPEAIAQARQFASEGLANERAMLELARAEK
TAGLPGWSLGQAAPGLDKILIRRSGLPIEQAVPGLYTEAGWAYARSGAAEEAIGKAKAETASLLHAGGET
SADAVMDLLQKRTLETWSRYLGDLRVRPFTDQPSAVIVSGVLSASNSPLSALIREVWRQAGGTDRSRSHA
NQLRIAATLGPAIQFVEQGRMSEISRLFVSLNVALAFLDGNSDIGKKSLMDAQERANSVVALQQAPLLVV
QMVEDVISQTASPKPVEKAEDPVPTAKPSGAWGEIATACQAAVAGHYPFFDGSDADLAEVARIFAPNGLV
ETYFRTQLAPLMDISTTPWRWKPGARLSGYAPESATFFQKASAIGDALFRQGNAPRLPVLLEALAQRGAA
TISIGGAHAPVTTSGGAVSFNWPGDLPSRGFEISFDSGSAVEKKSTPGPWGLLRFLDGSRLRPRDGGRRF
LIDVRATGARAYLQMSFAEPANPVSVRILMRELTCPSSL
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c1025150-1022721 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGCAAGCAGATGTGCTCGCCGCACTGGCGCAGCCGCTGCTGGATCTTGCTAGACGTGCCGAAAGCGAAA
AGAATCCAGATCCACGCGAGCTTGCGGCCATGGCACGGACCCTCGTCGCCGCCTTCGAGACGGAAGCACG
ACGCAGGAAAGTTCCCCCCGACTGGCTCCTGGATGCCCGCGATGCCCTTGTCGCTTTGGTTGATGCGCGA
GCGCGCAACAATCCGGCATTGCCGATCCGAAAATGGGAGCGCGCGCTTGCCGCTGCTCTTCCAATCGGGG
GCGTTATGGCGGCCAGCACCCTTGCCGAACGGGCGAGGGCGGCAGCGAAAGCAGGGCCTGCACGCCGGGA
TCTCGCCCGCTTCCTCGGCCACTGTAACGACGCTGTCCAGGCAGCACTTCTATCTCGCACGCAGCACAAA
ACCGATCGCGGTCTTGCCGCTCCTGTGATCGGCATCTTCCTGGCAGTTCTGGTGGTTTGGGCCGGATGGG
CCGAATGGCGGTTTCGTGAGCGGCTTTTGTCGCAGCTGCCCGATGTCGCACGTGTCGTAGAAGCAGGACG
CACGGCAAAACCGGCAGCCCGCGCAGCCCAACTCGACGCATTCCTTGCAGGAGTTCGACTTGTTGAGACG
GATGCGCAGCGTTCCCCCCTTGGTCTCATTCATCATTTAAGGATCTTTGATCCGGCAGAGGCCGCACGCC
GACGCTATGGCCAAGCCGTCGACGCCCTGGCCAGCGGCCCGCTTGCCGACGCCCTTGGTGTTGCTCTCGC
CACGGAAGGTGAGGCAACTGCACTTTACGATTCGCTGCGTGCCTGGTCTATCTTGAAGGGCACATCGGAC
TGGCAACCGCGGTTCCTGGCGGGCTGGATCGAAGATCGCACTCAGACATTTCCCGAACTTGCCGGCATGG
CAATGCATGTCGCTGCCATGTCCGGGCCTCCAGCAGATCTTGAAGAGCCGGATCCTGAAGCAATCGCTCA
AGCCAGACAGTTTGCTTCAGAGGGCTTGGCAAACGAGCGCGCCATGCTGGAACTCGCCCGGGCCGAGAAA
ACTGCGGGCCTGCCTGGCTGGTCCCTCGGGCAGGCAGCACCGGGCCTCGACAAGATCCTGATTCGCAGGT
CCGGACTGCCCATCGAGCAAGCCGTGCCTGGTCTTTACACTGAGGCAGGATGGGCTTACGCGCGCTCCGG
CGCTGCAGAAGAGGCGATCGGGAAGGCGAAGGCCGAAACTGCCAGCCTCCTGCACGCCGGAGGCGAGACA
AGCGCCGATGCAGTTATGGACCTGCTTCAGAAGCGAACCCTGGAGACCTGGTCCCGGTACCTCGGCGATC
TTCGCGTCAGGCCATTCACCGACCAACCGAGTGCGGTTATTGTCAGCGGCGTGCTCAGCGCGTCTAACTC
GCCGCTCTCGGCGCTGATCCGCGAGGTATGGCGTCAGGCGGGCGGCACCGACCGCAGCCGCAGCCACGCG
AACCAGCTTCGAATTGCCGCAACACTCGGACCTGCCATCCAATTCGTGGAGCAGGGTCGCATGTCGGAAA
TCTCCCGACTTTTCGTGTCGCTGAATGTCGCGCTTGCCTTTCTCGACGGAAATTCCGATATCGGCAAAAA
GTCGCTGATGGACGCACAGGAGCGTGCGAACTCCGTCGTCGCCCTGCAGCAGGCGCCGCTCCTCGTCGTC
CAAATGGTCGAAGACGTGATCTCGCAGACGGCATCTCCAAAGCCGGTAGAAAAGGCCGAAGATCCCGTCC
CGACGGCAAAGCCGTCAGGGGCTTGGGGCGAGATCGCGACGGCCTGCCAGGCTGCTGTCGCAGGCCACTA
TCCGTTCTTTGACGGGTCGGATGCGGATCTGGCTGAAGTCGCGCGCATTTTTGCGCCCAATGGTCTCGTG
GAGACCTATTTCCGGACGCAACTGGCGCCTTTGATGGATATATCAACGACGCCGTGGCGCTGGAAACCGG
GAGCACGGCTTTCTGGTTACGCGCCCGAAAGTGCGACATTCTTTCAGAAAGCTTCCGCGATCGGCGACGC
GCTCTTTCGCCAGGGAAACGCGCCGCGTCTTCCTGTATTGCTGGAGGCACTTGCGCAACGCGGTGCGGCT
ACCATCTCAATCGGCGGCGCTCACGCGCCGGTTACCACATCAGGCGGGGCGGTGTCCTTTAACTGGCCGG
GGGATCTGCCATCACGCGGCTTCGAGATCTCCTTCGATAGCGGCAGTGCGGTTGAGAAGAAGAGCACGCC
CGGGCCGTGGGGCCTGCTGCGATTTCTGGACGGGTCGCGCTTGCGGCCACGCGACGGCGGCCGGCGTTTT
CTCATAGACGTGCGGGCAACCGGCGCACGCGCCTACCTGCAGATGTCGTTCGCCGAGCCTGCCAACCCTG
TCTCCGTGCGCATCCTGATGCGGGAACTGACATGTCCATCGAGCCTCTGA
 Primer design