SecReT6
Protein ID: 190895277
SecReT6 ID291
T6SS typei3
Gene symbol-
Locus tagRHECIAT_PC0000950
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T6SS(s) in this replicon]
Location [Strand]1044562..1048092 [+]
Producthypothetical protein
NoteTssM
UniProt IDB3Q4B3
KEGG IDrec:RHECIAT_PC0000950
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-85, Aligned region: 189..447
IcmF-related [PF06761], Evalue: 3.40E-71, Aligned region: 502..802
DUF1215 [PF06744], Evalue: 1.70E-32, Aligned region: 918..1035
Protein Sequence: 1176 a.a.     [Download]
>gi|190895277|ref|YP_001985570.1| hypothetical protein RHECIAT_PC0000950 [Rhizobium etli CIAT 652]
MAIFRFLWAFLTSRWLWTFIGLILLSLIVWIFGPIVSVGDSAPFASEIVRLVIIGLLFLVFIIWWVAARR
RAMRANRLFVSEIAPQPEAPPSPAEEGVAAVGVKFREVMADLKRRKVGGRKFLREMPWYVIIGPPATGKT
TALRQSGLNFPIDLSDDLHGVGGTRNCDWFFTEEAVLIDTAGRYVQQESQPEVDAAEWLGFLDLLKKHRG
RRALNGVVVALGIDTLSEDDAAIRMHGRQIRKRLAELQERIGIRLPVYLMLTKADLIKGFESFFGALSTA
DREQVWGVTFPPGARIDGTEVTGEFSALAGVLERRLIPRLEGEENLAARAEIFRFPAQVESLSEPVRVLI
ETVFGESKYSESAWLRGIYLTSATQEGTAIDRLTAALASSFGLPAQPAAPMLRAEKRSFFLKDLLTKVIF
KEAGLGTFDPAAEDRRIWIWRGAAVAATAFVVIASLLFTISYRKNDAALAAQAEQLEALQLPLTPVAARQ
APVDPLDLDLALEAVTDVANARTDQPGGIAALIGPSAETEIGQAQSDAYNRTLRNILEPRMVALLEATMW
RQIRDPEFQLGALKTYRMMTGLSPMDPDFAKQWWTEKLPESAPVPPFKTEMAADHQLAAIDNMATEQTFV
APDEALVGEALRTICSIPLPVRAYSALLSDPEVTALKEWVPADHVGPNGLKVLARRSDKTLRVGISGAFT
YDGFHNVILTRLEDVATQAALDRSVFAGGCSESASPSVAALSQDILKLYYDDYIAKWDSFMRDIRLAPLA
DLQTASENLKDLSSADSSMKRLLTAIVRETELTRPDDDGGGQAPPPGASKLLSKLGKIGKLAAKGVKMMP
AAGSKSDVDLSGALVADHFKPIKAAIVEVDGQPPALNDAVAALTALSNMLQTVSASPDAQDAMKRQGGLA
ELTGAVAKQAVTLPDPLDDWLAGLAGNTSALATGAVTSELNAIWRADVLPFCQAALTNRYPFVPDSAIDV
NVVDFQRVFGPGGLIDSFINNNLVNYIDTTSHPWKWRSDIKLDPGPLAALEQARLIRDSLFPGGAGPILT
FTLEPKDLSPTVSRVTLNVDGQSLSYFNNPTRPQPMTWPGKDGTGVITLAFQPLDGSPEVMVSETGSWAF
LRMLRAGRLSGTNLAELYKLRLAAQGYYADFELRAASVANPFDLKMFARFSCPTQL
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|190894340|ref|NC_010997.1|:1044562-1048092 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGCGATCTTCCGGTTCCTCTGGGCCTTCCTCACCTCTCGTTGGCTATGGACCTTCATCGGGCTCATTT
TGCTATCCCTCATCGTCTGGATCTTCGGTCCGATCGTCAGCGTCGGAGATAGCGCGCCGTTTGCTTCCGA
AATCGTGCGATTGGTCATCATCGGCCTTTTGTTCCTCGTGTTCATCATCTGGTGGGTTGCGGCGCGGCGG
CGTGCGATGCGCGCCAACCGCCTGTTCGTTTCCGAGATTGCCCCGCAGCCCGAGGCGCCGCCAAGTCCGG
CTGAAGAGGGCGTTGCCGCCGTCGGAGTGAAGTTCCGGGAGGTCATGGCGGATCTCAAGCGCCGGAAGGT
CGGCGGCCGAAAGTTTCTCCGCGAGATGCCTTGGTACGTGATTATCGGCCCCCCTGCGACGGGCAAGACA
ACAGCCCTGCGTCAATCCGGACTAAACTTTCCAATCGATCTCAGCGACGATCTTCATGGTGTTGGCGGCA
CGCGCAATTGCGATTGGTTCTTCACCGAGGAGGCGGTGCTGATCGATACCGCCGGCCGCTACGTTCAGCA
GGAGAGCCAGCCGGAGGTCGATGCAGCGGAATGGCTGGGCTTCCTCGATCTCTTGAAAAAGCACAGAGGC
CGACGTGCGCTAAATGGCGTCGTCGTGGCGCTCGGCATAGACACGCTCTCCGAGGACGATGCGGCGATCC
GGATGCATGGAAGACAGATCCGCAAACGCTTGGCCGAGCTTCAGGAACGCATCGGTATTCGCTTGCCCGT
CTACCTCATGCTGACGAAAGCCGACCTGATAAAGGGCTTCGAAAGCTTCTTCGGTGCGCTCTCCACCGCC
GATCGTGAACAGGTGTGGGGTGTAACATTCCCCCCGGGCGCGCGCATCGACGGCACCGAAGTCACCGGGG
AATTCTCCGCCTTGGCGGGCGTGCTCGAACGACGTCTCATTCCGCGCCTCGAAGGTGAAGAGAATCTGGC
CGCCCGGGCCGAAATTTTTCGTTTCCCAGCCCAGGTCGAAAGCCTTTCAGAACCGGTTCGTGTGCTGATC
GAGACCGTCTTCGGCGAAAGCAAATATTCGGAGAGCGCCTGGTTGCGGGGTATCTATCTCACCTCCGCCA
CTCAGGAAGGCACGGCAATAGACCGGCTGACAGCAGCATTGGCATCATCCTTCGGCCTGCCTGCCCAACC
CGCCGCACCAATGCTGCGGGCCGAAAAGCGCAGCTTCTTTCTCAAAGACCTGCTGACGAAGGTCATTTTC
AAGGAGGCTGGCCTCGGCACCTTCGATCCGGCGGCCGAGGATCGGCGTATCTGGATATGGCGCGGCGCCG
CCGTGGCAGCAACGGCATTCGTGGTCATTGCCAGTCTGTTGTTCACGATATCCTATCGGAAGAACGATGC
CGCCCTCGCGGCGCAGGCCGAGCAGCTCGAAGCCCTGCAGCTTCCCCTGACCCCGGTTGCGGCACGCCAA
GCGCCGGTCGACCCTCTTGATCTCGATTTGGCGCTCGAAGCCGTCACGGACGTGGCGAATGCACGGACCG
ACCAGCCAGGCGGAATAGCTGCCCTGATAGGTCCTTCCGCCGAAACCGAAATTGGCCAGGCGCAGTCGGA
CGCCTATAACCGCACCCTGCGCAATATATTGGAACCTCGCATGGTCGCCCTGCTCGAGGCGACGATGTGG
CGGCAGATCCGCGATCCAGAGTTCCAGTTGGGCGCGCTGAAAACCTATCGCATGATGACCGGCCTGTCGC
CGATGGACCCGGACTTTGCCAAACAATGGTGGACGGAGAAATTGCCCGAATCGGCCCCCGTGCCGCCTTT
CAAGACCGAGATGGCAGCGGATCATCAGCTTGCAGCGATCGACAATATGGCCACGGAACAGACTTTCGTC
GCTCCTGACGAAGCGCTGGTGGGTGAAGCGCTCCGCACGATTTGCTCAATCCCGCTGCCGGTGCGCGCCT
ATAGCGCATTGCTCTCCGATCCGGAGGTCACGGCTCTGAAGGAATGGGTCCCGGCGGACCATGTCGGCCC
CAACGGCCTGAAGGTTCTGGCGCGACGCTCCGACAAGACGCTGAGGGTCGGTATCAGCGGTGCCTTCACC
TATGACGGATTTCATAATGTGATCCTGACCCGGCTTGAAGATGTTGCAACGCAGGCCGCGCTGGACCGCT
CAGTCTTTGCCGGCGGGTGTTCGGAGAGCGCCAGCCCCTCGGTCGCCGCTCTCTCGCAGGATATCCTCAA
GCTCTACTATGACGACTATATCGCCAAGTGGGACAGCTTCATGCGTGACATCAGGCTTGCACCACTGGCC
GACCTGCAGACCGCCAGCGAAAACCTTAAGGATCTCTCCAGCGCCGATTCCTCGATGAAGCGTCTGCTAA
CCGCCATCGTACGGGAGACGGAACTGACCCGTCCCGATGACGATGGCGGCGGCCAGGCACCTCCGCCGGG
AGCATCCAAGCTGTTGTCCAAGCTCGGCAAGATAGGCAAACTCGCCGCCAAGGGCGTGAAGATGATGCCT
GCAGCCGGCTCCAAGTCGGACGTCGATCTTTCTGGCGCGCTGGTCGCGGACCATTTCAAACCCATCAAGG
CTGCTATTGTCGAGGTCGATGGCCAGCCTCCCGCACTCAACGATGCCGTCGCAGCCTTGACCGCGCTGTC
GAACATGCTTCAGACCGTGTCGGCAAGCCCGGATGCGCAGGACGCGATGAAAAGACAGGGCGGACTGGCC
GAGCTGACCGGCGCAGTGGCAAAACAAGCCGTGACCCTTCCCGATCCGCTGGACGACTGGCTGGCCGGAC
TGGCCGGCAATACGAGCGCTCTGGCAACAGGAGCGGTCACTTCAGAGCTCAATGCCATCTGGCGTGCCGA
CGTGCTTCCCTTCTGCCAGGCAGCGCTCACCAACCGCTATCCGTTCGTCCCCGACAGCGCAATCGACGTC
AATGTCGTCGATTTTCAGCGCGTCTTTGGTCCCGGCGGCCTGATCGACAGTTTCATCAATAATAATCTGG
TCAACTACATCGACACGACCAGCCATCCCTGGAAATGGCGCTCCGACATCAAGCTCGATCCCGGGCCTCT
GGCGGCGCTGGAGCAGGCGCGGCTGATCCGCGACAGTCTCTTTCCGGGGGGCGCCGGGCCAATCCTGACC
TTCACGCTCGAGCCGAAAGATCTCTCGCCGACAGTCAGCCGCGTGACCTTGAATGTCGACGGTCAGAGTC
TCTCCTACTTCAACAACCCGACGCGCCCGCAGCCAATGACCTGGCCCGGCAAGGATGGCACCGGTGTGAT
CACCCTCGCCTTCCAGCCCCTCGATGGTTCGCCGGAAGTGATGGTCAGCGAGACTGGAAGCTGGGCATTT
CTGCGGATGCTGCGCGCCGGTCGGCTGAGCGGGACCAATCTTGCCGAACTTTACAAGCTGCGCCTTGCTG
CCCAAGGGTATTACGCCGATTTCGAGCTTCGCGCGGCAAGTGTCGCCAATCCCTTCGACTTGAAGATGTT
TGCGAGGTTCTCGTGCCCGACGCAGCTTTGA
 Primer design