SecReT6
Protein ID: 194288766
SecReT6 ID266
T6SS typei3
Gene symbolsciS
Locus tagRALTA_A0621
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome I [GenBank: NC_010528] [Browse all T6SS(s) in this replicon]
Location [Strand]644032..647856 [+]
Productreplication related protein
NoteTssM
UniProt IDB3R2S3
KEGG IDcti:RALTA_A0621
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.20E-99, Aligned region: 578..898
ImcF-related_N [PF14331], Evalue: 1.50E-92, Aligned region: 255..531
DUF1215 [PF06744], Evalue: 1.60E-30, Aligned region: 1007..1131
Protein Sequence: 1274 a.a.     [Download]
>gi|194288766|ref|YP_002004673.1| replication related protein [Cupriavidus taiwanensis LMG 19424]
MEFLKRVGAVLFSRHTLAFIAVLVVAAAIWFIGPLLGFNGMRPLAGTGARAALIVLLLALALFWLLGWPV
STIGAAALCLLIWHAGSLLAIGTMHPLEPASVRILLIAAIVFVFAAYLLYLLWQRARTDKTFVESLLNFG
SKRQEVVAKEDIARLNAAVQTALRQLKSMRTGSRVARLFEGRRYLYELPWYMMVGVPGAGKTTALLNAGL
QFPIAEQMSAAARARHGTEQTNWWFTNEAVLIDTAGRYTAQESGSATDPAEWRGFLGLLRKYRARAPING
ALVTISVEDLLRHSSEQRVVEAASIRARLAELREALGIQFPIYVLVTKLDQLAGFADYFQYLTSEGRAQP
WGFTLPAMARRRPGQPAVDPWALCREEMRSLVTRLEAGLDGRLYEEFDLTRRKALYALSDELASVTEPLV
AMLEQIFLDSRYDDTERSAMLRGVYFTSAAQTGAAVVADAGTVIRQVRGIAPSDTGAAGAATDPATGNRS
YFLQDVFKRIIVPEAHLVKPNLRWEFRFRLLRLLGHVLALVIFLWLAGSLYASFGHNRSYLDQVQDKAKA
LAATVTSFYKKPAPEAMPEVLAAARDLPAYAGLDLADPSVDWRYGLYSVPPVLDAAILTHARLQDNLLVP
YLVRRVESVLSAAVNQRDAKATYDTLRVYLMLHDAGKFNASDVRSWVQSDWATGSGADAFGGRVAVLEHL
DSLLDGKRPVQSPYARNEALIRSARDFLDGNTSTERVYERAKAAMTEEAPQDFTLVRAVGPQAGTVFTRA
SGEPLERGIPGLFTYAGYHDVFNARLPEFVARARAMDAWVMGRAEGREAQKKTVDGAVGRLAGNDPLTRE
IRRLYLNEYAQHWEKFLGDIRTVTGNNLAFDLEILRNFAAPDSPLARLGRAAVQETTLSRQVEPEDKSLA
EKALSALDKKTGKASALSVRAEARQERELVDNRFAALREVVTGQADLSAPDAPAAAGKPQLDGIAGMVNA
YYTSLVVANNALSTRNLPPPAEAGEQLRMEAAKLPAPFNAVLADLVVQGARDVNKGVGDILIAQMDAVIG
ESCRSAIDGKYPFTPTSTQDVDPEDFARVFAAGGVLDDFFQKVLAPHVDTTISPWRYRLSAPDVPPVAGP
SLVPFQRAREIREVFFRDPGAKKMAWKVDLKVVELDPEIVELNMDFDGQSQRYVHGPVIPLKVTWPGPRG
GQGAEISASPRIRPDTSTLAANGPWALMRVIARGRLAGSASASHFMAEYDFDGRKAKLDINTGSLANPWT
TGLLQGFQCPGRSG
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|188590795|ref|NC_010528.1|:644032-647856 Cupriavidus taiwanensis LMG 19424 chromosome 1, complete sequence
ATGGAATTTCTGAAACGAGTTGGCGCAGTGCTGTTCTCCCGGCACACACTGGCCTTCATTGCCGTGCTCG
TGGTCGCGGCAGCCATCTGGTTTATCGGGCCGCTGCTTGGCTTCAATGGCATGCGTCCGCTTGCGGGCAC
CGGAGCGCGTGCAGCGCTCATCGTGCTGTTGCTCGCGCTGGCGCTGTTCTGGCTGCTTGGCTGGCCGGTA
TCCACCATCGGTGCTGCTGCCCTGTGCCTGCTGATCTGGCATGCGGGTTCGTTACTGGCCATTGGCACCA
TGCATCCGCTGGAACCGGCTTCCGTCCGTATCCTGCTGATCGCGGCGATTGTGTTTGTGTTCGCCGCATA
CCTGTTGTACCTGCTTTGGCAGCGTGCGCGCACGGACAAGACCTTTGTCGAGAGTCTGCTGAACTTTGGC
AGCAAGCGGCAGGAAGTGGTGGCCAAGGAAGACATTGCCAGGCTGAACGCGGCGGTCCAGACTGCGCTGC
GGCAGCTCAAGAGCATGCGCACCGGCAGCAGGGTGGCTCGCCTCTTCGAGGGCCGACGCTATCTCTACGA
GTTGCCCTGGTACATGATGGTTGGCGTGCCGGGAGCCGGCAAGACGACGGCGTTGCTGAACGCCGGGCTG
CAATTCCCCATCGCCGAGCAGATGAGTGCGGCGGCGCGCGCGCGGCATGGTACCGAGCAGACGAACTGGT
GGTTCACCAATGAGGCGGTGCTGATCGACACGGCCGGCCGCTACACCGCGCAGGAATCGGGTTCGGCGAC
CGACCCGGCTGAATGGAGAGGCTTCCTTGGCCTGCTTCGCAAGTACCGCGCCAGGGCCCCGATCAATGGC
GCGCTGGTGACGATCAGCGTGGAGGACCTGCTTCGACACTCCAGCGAGCAGCGTGTGGTGGAAGCGGCAA
GCATCCGGGCACGCCTGGCCGAACTGCGCGAAGCGTTGGGCATCCAGTTTCCCATCTACGTGCTGGTGAC
CAAGCTCGACCAGCTTGCGGGCTTCGCTGATTACTTCCAGTACCTGACCAGCGAAGGACGAGCCCAGCCT
TGGGGCTTTACCTTGCCAGCCATGGCGAGGCGGCGGCCGGGACAGCCGGCCGTTGATCCTTGGGCGCTGT
GCCGTGAGGAGATGCGATCTCTGGTGACGCGATTGGAGGCAGGGCTGGACGGGCGGCTGTATGAGGAATT
TGATCTGACCCGGCGCAAGGCACTCTACGCCCTGAGTGATGAGCTTGCGAGCGTGACGGAGCCGCTGGTC
GCTATGCTGGAACAGATATTCCTGGACTCGCGGTATGACGACACTGAGCGCAGCGCCATGCTGCGCGGCG
TGTACTTTACCAGCGCCGCGCAAACCGGCGCAGCAGTGGTAGCGGATGCCGGCACCGTCATCAGGCAGGT
GCGTGGCATCGCGCCTTCCGATACCGGGGCTGCCGGCGCCGCCACGGATCCGGCCACCGGCAACCGCAGC
TACTTCCTGCAGGACGTCTTCAAGCGCATCATCGTGCCCGAAGCTCATCTGGTGAAGCCAAACCTGCGCT
GGGAGTTCCGCTTCCGCCTGCTGCGGCTGCTCGGGCATGTGCTGGCACTGGTGATCTTCCTGTGGCTGGC
CGGGTCGCTGTATGCCAGCTTTGGCCATAACCGCAGCTATCTGGATCAGGTGCAGGACAAAGCCAAGGCG
CTGGCAGCGACCGTGACGTCCTTCTACAAGAAGCCGGCACCGGAAGCCATGCCCGAAGTGCTGGCGGCCG
CGCGCGACCTGCCTGCCTATGCCGGACTGGACCTGGCCGATCCGTCTGTCGACTGGCGTTATGGCCTGTA
CAGCGTGCCGCCGGTGCTGGACGCCGCGATCCTGACCCATGCCCGGCTGCAGGACAATCTGCTGGTGCCG
TACCTGGTGCGGCGGGTCGAGTCGGTGCTGTCGGCTGCGGTCAACCAGCGCGACGCCAAGGCGACCTACG
ATACCCTGCGGGTCTACCTGATGCTGCACGACGCGGGCAAGTTCAATGCGTCCGACGTGCGTAGCTGGGT
GCAGAGCGATTGGGCCACGGGAAGCGGGGCGGACGCTTTCGGTGGCAGGGTGGCGGTACTGGAGCACCTG
GACAGCCTGCTGGACGGCAAGCGTCCGGTCCAGTCACCGTACGCCAGGAACGAGGCGTTGATCCGCTCGG
CGCGCGATTTCCTGGATGGCAACACTTCGACGGAGCGCGTGTACGAACGTGCCAAGGCAGCCATGACCGA
GGAGGCGCCACAGGATTTCACGCTGGTGCGCGCGGTCGGTCCCCAGGCCGGCACGGTCTTCACCCGCGCC
AGCGGTGAGCCGCTGGAGCGCGGCATCCCCGGCCTTTTCACCTACGCCGGCTACCATGACGTGTTTAATG
CCCGCCTGCCAGAGTTCGTTGCCAGAGCCCGGGCCATGGACGCGTGGGTGATGGGGCGTGCAGAGGGGCG
CGAGGCTCAAAAAAAAACGGTTGACGGTGCCGTCGGCAGGCTTGCGGGCAACGATCCGCTCACGCGCGAG
ATTCGCCGTCTCTACCTGAACGAGTATGCCCAACATTGGGAAAAGTTCCTCGGTGACATCCGGACGGTGA
CGGGCAATAACCTGGCGTTTGATCTGGAGATCCTGCGTAATTTTGCCGCGCCGGATTCCCCGCTTGCACG
GCTGGGGCGGGCGGCGGTGCAGGAGACCACGCTCAGCCGCCAGGTCGAGCCCGAAGACAAGTCTCTTGCG
GAGAAGGCGCTGTCGGCGTTGGACAAGAAGACCGGCAAGGCCAGTGCACTGAGCGTGCGCGCCGAGGCCC
GCCAGGAACGTGAACTGGTCGACAACCGCTTCGCCGCGCTGCGCGAAGTGGTGACCGGCCAGGCTGACCT
GTCGGCGCCGGACGCGCCGGCTGCCGCCGGTAAGCCGCAACTGGATGGAATCGCCGGCATGGTCAACGCT
TACTACACCAGCCTGGTCGTCGCCAACAATGCGCTGAGCACCCGCAACCTGCCGCCGCCGGCAGAGGCCG
GCGAGCAGCTGCGCATGGAGGCGGCCAAGCTGCCTGCACCCTTCAACGCTGTGCTGGCAGACCTGGTCGT
GCAGGGCGCCCGGGACGTCAACAAGGGCGTGGGCGATATCCTGATCGCGCAGATGGACGCCGTTATCGGC
GAGAGCTGCCGCAGTGCCATCGACGGCAAGTATCCGTTCACGCCGACGTCCACGCAGGATGTGGACCCGG
AAGACTTTGCCCGCGTCTTCGCCGCGGGCGGCGTACTGGACGATTTTTTCCAGAAGGTGCTGGCGCCGCA
CGTGGATACCACCATCTCGCCCTGGCGCTACAGGCTGAGCGCGCCCGACGTGCCGCCCGTGGCTGGCCCC
AGCCTGGTTCCATTCCAGCGCGCCAGGGAGATCCGGGAAGTGTTCTTCCGGGATCCGGGCGCGAAGAAGA
TGGCGTGGAAAGTCGACCTGAAGGTGGTGGAACTCGACCCCGAGATCGTCGAACTCAATATGGACTTTGA
CGGACAGAGCCAGCGCTATGTGCATGGGCCGGTTATCCCGCTCAAGGTGACCTGGCCCGGACCACGGGGC
GGGCAAGGGGCCGAGATCAGCGCCAGCCCGCGGATTCGCCCGGACACTTCGACGCTGGCGGCCAACGGCC
CGTGGGCCCTGATGCGGGTGATCGCCAGGGGCCGCCTTGCCGGTTCCGCCTCGGCCAGCCATTTCATGGC
CGAGTACGACTTCGACGGCCGCAAGGCGAAGCTCGATATCAATACCGGCAGCCTGGCCAATCCCTGGACC
ACCGGCCTGCTGCAGGGCTTCCAATGCCCGGGGAGGTCCGGGTGA
 Primer design