SecReT6
Protein ID: 194291767
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1008
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1050243..1053053 [-]
Producthypothetical protein
NoteTssI
UniProt IDB3R9P2
KEGG IDcti:RALTA_B1008
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-65, Aligned region: 45..357
Phage_GPD [PF05954], Evalue: 2.70E-65, Aligned region: 454..498
Phage_GPD [PF05954], Evalue: 2.70E-65, Aligned region: 724..764
DUF2345 [PF10106], Evalue: 4.60E-42, Aligned region: 677..824
T6SS_Vgr [PF13296], Evalue: 2.30E-34, Aligned region: 523..633
T6SS_Vgr [PF13296], Evalue: 2.30E-34, Aligned region: 726..742
Phage_base_V [PF04717], Evalue: 7.70E-17, Aligned region: 416..507
Sarcoglycan_1 [PF04790], Evalue: 0.008, Aligned region: 752..807
Protein Sequence: 936 a.a.     [Download]
>gi|194291767|ref|YP_002007674.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MKPLSSYPSSAMAALSGLLGQRTRQITLETALTADDLVVERFVAQESVSTPFQLHIDCLSPSAHLDTARL
ATEEITLRLMLADGSRRAWHGYVQTCAAIGGDGGLARYRLTVGTWFDHLRARTDCYVYQDKTALEIIEDV
LADYPLAQYRMAVSQPLRKRSVCCQYRETDLDFVTRLLAEEGLSYRFEHQQDGAEQSSREDKAQSRHCLV
IFDNQAERPACAQPSIRFHRSDATEHEDAIDHWSLQAATGTNAVTVASWDYKSLAATAADAGNESLGEWP
ALESFETRGTYRFPDADAARRAAQLRAQAHESCYLRYEGEGSVRALGAGERFTLTGHFDTAANEFVTLAV
RHEAANNLGAEVALLLGMSDIEAGSYRNRFEAVRADAPIVPVYSPKPTAPEGQPAVVIAEGGAPLTTERD
HRVRVRLPWLRAPMADPRADTAADPAQDDLSQVTAWVRVATAAAGPNWGVHHLPRAGTEVMLTYLDGDID
RPMVVAQLHNEQDTLPWPATEAPLNTALSGWHSHNLGDGGYNQWIVDDNTGQLRMRLASSAADTQLNLGY
VIAQPPASGERGAWRGTGAELRTDAWAIVRAGNGLLLSTTVQARAAGTMLDIREARGQITAAERTAQRLS
DAATSQQALPLGALAAFEPLTKAIDPQQDGSYPDRVNEQDARRPDTGTAAERFGQPWLVAESPSSIALAT
QATTSIFAGRHLLGLAQADWHVGADNTVAAAAAKGVSLFSQNNGIRAIAAGGPVSIQAHTDALAVMADKA
VTVTSSTDGIEVLAQKKVVLHGGSSRIVLDGNAITFETPGLLSVKGAGHPLVGGGGNAAALPALPIPASQ
PNWIEMSLLGYEGQPMRNIEYELTFADGTKRTGKLNGVAEQREEAVPWGQATLTYKNNPAAKDVPRPSLD
DLLAATEPLIREEEARLNQDQTNTTA
 
Nucleotide Sequence: 2811 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1053053-1050243 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGAAGCCCTTGTCCTCTTACCCGTCATCCGCGATGGCTGCCCTGTCCGGGCTGCTGGGCCAACGCACGC
GCCAGATCACGCTGGAGACGGCGCTTACCGCCGACGACCTGGTAGTGGAGCGCTTCGTCGCGCAGGAGAG
TGTCAGCACACCGTTCCAGCTGCACATCGATTGCCTGAGCCCGTCTGCACACCTGGACACCGCGCGCCTG
GCCACCGAGGAAATCACGCTGCGGCTGATGCTTGCCGACGGCAGCCGCCGCGCCTGGCACGGCTATGTGC
AAACCTGCGCGGCCATCGGCGGCGACGGTGGCCTGGCGCGCTACCGGCTGACGGTGGGGACCTGGTTCGA
TCACCTGCGCGCGCGCACCGATTGCTATGTGTACCAGGACAAGACCGCGCTGGAAATCATCGAAGACGTG
CTGGCTGACTATCCGTTGGCCCAATACCGCATGGCGGTGAGCCAGCCGCTGCGCAAGCGCTCGGTCTGCT
GCCAGTATCGCGAGACCGATCTTGACTTTGTCACGCGGCTGCTGGCGGAAGAAGGCCTGTCTTATCGCTT
CGAGCATCAACAGGACGGCGCCGAACAATCCAGCCGGGAGGACAAGGCCCAGTCCCGTCATTGCCTGGTC
ATCTTCGACAACCAGGCCGAACGCCCCGCCTGCGCGCAGCCCAGCATCCGCTTCCATCGCAGCGACGCCA
CTGAGCACGAAGACGCCATCGACCATTGGTCGCTGCAGGCAGCCACTGGCACCAACGCCGTCACCGTGGC
CTCATGGGACTACAAGTCCCTGGCCGCCACCGCCGCCGACGCCGGCAACGAAAGCCTGGGTGAATGGCCC
GCGCTGGAATCCTTCGAAACGCGCGGCACGTACCGCTTCCCCGACGCCGATGCCGCCCGCCGCGCCGCGC
AGCTGCGCGCGCAAGCGCATGAAAGCTGCTACCTGCGCTACGAGGGCGAAGGCAGCGTCCGCGCCCTGGG
CGCCGGCGAACGCTTCACGCTGACCGGGCACTTCGACACCGCCGCGAACGAGTTCGTCACGTTGGCGGTG
CGCCATGAAGCGGCCAACAACCTGGGGGCCGAGGTCGCGTTGCTGCTGGGCATGTCCGACATCGAGGCCG
GCAGCTACCGCAACCGCTTCGAAGCCGTGCGCGCCGATGCCCCGATCGTGCCGGTGTACTCGCCCAAGCC
CACCGCTCCGGAAGGACAGCCTGCCGTCGTCATCGCCGAAGGCGGCGCCCCGCTGACCACCGAGCGCGAT
CACCGCGTGCGCGTGCGCCTGCCCTGGCTGCGCGCGCCGATGGCCGATCCCAGGGCCGACACCGCCGCCG
ACCCGGCCCAGGACGACCTGAGCCAGGTCACCGCCTGGGTGCGCGTGGCGACCGCCGCAGCCGGTCCCAA
CTGGGGCGTGCATCACCTGCCCCGCGCCGGCACTGAGGTCATGCTGACCTACCTCGATGGCGACATCGAT
CGCCCGATGGTCGTGGCGCAACTGCACAACGAACAGGACACCCTGCCCTGGCCCGCCACCGAGGCGCCGC
TGAACACAGCGTTGTCCGGCTGGCATTCGCACAACCTCGGCGACGGCGGCTACAACCAGTGGATCGTCGA
CGACAACACCGGCCAGCTGCGCATGCGCCTGGCCAGCTCGGCCGCCGACACCCAGCTCAACCTTGGCTAC
GTGATCGCGCAGCCTCCCGCCAGCGGAGAACGCGGCGCCTGGCGTGGCACCGGCGCCGAACTGCGCACCG
ACGCGTGGGCCATCGTGCGCGCCGGCAACGGCTTGCTGCTGTCGACAACGGTCCAGGCCAGGGCCGCCGG
CACCATGCTCGACATCCGCGAAGCCCGCGGCCAGATCACCGCCGCCGAGCGTACCGCCCAGCGCCTGTCC
GATGCCGCCACCTCGCAGCAGGCGCTGCCGCTGGGAGCGCTCGCCGCGTTCGAACCGCTGACCAAGGCCA
TCGACCCGCAGCAGGACGGCAGCTATCCGGACCGCGTCAACGAGCAGGACGCCAGGCGCCCGGATACCGG
CACCGCTGCCGAGCGCTTCGGGCAACCGTGGCTCGTCGCGGAATCGCCCAGCTCGATTGCACTGGCCACG
CAGGCCACCACCAGCATCTTTGCCGGACGCCACCTGCTGGGACTGGCACAGGCCGACTGGCATGTCGGCG
CCGACAACACCGTCGCCGCGGCCGCGGCCAAGGGCGTGAGCCTGTTCAGCCAGAACAACGGGATTCGCGC
CATTGCGGCCGGCGGACCGGTTTCCATCCAGGCGCATACCGATGCGCTGGCAGTGATGGCCGACAAAGCC
GTGACGGTGACCTCATCGACCGACGGCATCGAGGTGCTGGCGCAGAAGAAAGTGGTGCTGCACGGCGGCT
CGTCGCGGATCGTGCTGGATGGGAATGCGATTACGTTTGAGACACCGGGGTTGTTGTCGGTGAAGGGGGC
TGGGCATCCGTTGGTGGGGGGTGGGGGGAATGCCGCGGCGTTGCCGGCGTTGCCAATTCCAGCAAGTCAG
CCCAACTGGATCGAGATGAGCCTGCTGGGCTATGAAGGTCAGCCTATGCGCAACATCGAATACGAACTCA
CGTTTGCCGACGGCACCAAGCGTACGGGCAAGCTGAATGGCGTTGCCGAGCAGCGGGAAGAAGCCGTGCC
ATGGGGTCAAGCCACGCTCACGTACAAGAACAACCCGGCTGCAAAGGACGTGCCCCGGCCCTCTCTGGAT
GACCTGCTGGCGGCCACTGAACCGCTCATCCGTGAAGAGGAAGCACGGCTAAACCAGGACCAGACGAATA
CGACCGCATGA
 Primer design

Protein ID: 194291779
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1020
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1065896..1068694 [+]
Producthypothetical protein
NoteTssI
UniProt IDB3R9Q4
KEGG IDcti:RALTA_B1020
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-72, Aligned region: 42..364
Phage_GPD [PF05954], Evalue: 2.70E-72, Aligned region: 532..558
Phage_GPD [PF05954], Evalue: 2.70E-72, Aligned region: 674..731
DUF2345 [PF10106], Evalue: 2.10E-40, Aligned region: 740..897
T6SS_Vgr [PF13296], Evalue: 1.20E-26, Aligned region: 598..703
Phage_base_V [PF04717], Evalue: 2.60E-18, Aligned region: 431..535
Protein Sequence: 932 a.a.     [Download]
>gi|194291779|ref|YP_002007686.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MVAATDLAKLLGAAFSQANRLLRLQTPLGHDALMPEQLQAAEQLDGGGFRIDLTAVSDNAGIEAQSLLGQ
AVRIDLLTQRSRTTLRPFHGHVTRFERVGANGGLARYRIVVEPWLALLRHRRDSFLFQDMSVVDVVDSVF
GDYNGQGKLVPAWRWALRDASAYPRRSIVTQYEESDFDFVTRLLAEEGLFYYFEHEAADGEALGTHRMVI
ADANDVFQDNEQASIRFGRADATAAEDVIDRWQGARRLQTNTVAVASWDYRAKAVRSAEAGAPAEGNSAA
PTLQDTDYPGQYWFEDGDQAQRHARQLVEALEVRRLSFAGEGSVRTLAPASRFMLTGHYDYERVQGDDER
RFVVLAVAHAARNNLNERFRGVIDQLLGTGQSTEAPAEDASAVDVPFYRNQFTVVPAKIPYRPQQLDGQG
RQLHPRPTVTGAQTAIVIGTDGPVHTDRDHRVMVQFHWQRGARSASRLSHPAGDDNARAEAGLGTWVRVA
TPVAGANWGGVALPRVGQEVVVEFQHGDIDRPVVIGAAYNGRGQASAQYNQNQTGAANATGNAPAWFAGS
NETADGKQDGNGKPDGQQGHVHNAVLSGIKTQALGHSQDGTGGYNQLVFDDTSGQSRTLLSTTQAASALT
LGHHLDQRDNARQAALGHGAALETADSGALRGGAGMLLTAHGAGTSVPLLDSEGAATQVEASTELLTSLA
DVARKQKADLPDEPAPAELPAIAQLKHTTEVLRHTEEGADGKASATAYNEPHLQVSAPKGIAATTPADAV
LVAGTQLTVAAQKDANVAAGGNLSVAVADGLSLFTHGKAGDESAAGIAMHAASGKVGVASLQGQGRIAAE
KRVTVSSSQGAVNVQAKEHVLLNAAGAQIRVLGNTIEVHAPGMTTFKGAQHLFVGPGGREANTSLPKGEL
PLCEYQAMGAESTGAGIVPIQS
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1065896-1068694 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGTTGCAGCGACCGACCTGGCCAAACTGCTTGGCGCCGCTTTCTCGCAGGCCAACCGCTTGCTGCGCC
TGCAGACGCCCCTTGGGCACGACGCGCTGATGCCCGAGCAGCTGCAGGCGGCAGAGCAGCTGGACGGCGG
CGGGTTCCGCATCGACCTGACGGCGGTGTCGGATAACGCCGGCATCGAGGCGCAAAGCCTTCTGGGCCAG
GCCGTGCGCATCGACCTGCTGACCCAGCGCAGCCGCACCACGTTGCGGCCCTTCCATGGCCACGTCACGC
GCTTCGAGCGCGTGGGCGCCAACGGCGGGCTGGCGCGCTACCGGATCGTGGTGGAGCCTTGGCTGGCCCT
CCTGCGCCACCGCCGCGACAGCTTCCTGTTCCAGGACATGTCGGTGGTCGACGTGGTGGACAGCGTGTTC
GGCGACTACAACGGCCAGGGCAAGCTGGTGCCGGCGTGGCGCTGGGCGCTGCGCGACGCGTCGGCCTATC
CGCGCCGCAGCATCGTCACGCAGTACGAAGAGAGCGACTTCGACTTCGTGACGCGGCTGCTCGCCGAAGA
AGGCTTGTTCTACTACTTCGAGCATGAAGCCGCGGATGGCGAGGCACTCGGCACGCACCGCATGGTGATC
GCCGATGCCAACGATGTCTTCCAGGACAACGAACAAGCCAGCATCCGCTTCGGCCGCGCCGATGCCACCG
CTGCCGAAGACGTGATCGATCGCTGGCAAGGTGCGCGCAGGCTGCAGACCAATACTGTGGCCGTGGCCAG
CTGGGACTATCGCGCCAAGGCGGTGCGCAGCGCCGAGGCCGGTGCGCCGGCCGAGGGCAATTCAGCCGCT
CCGACCCTGCAGGATACCGACTATCCCGGCCAATACTGGTTCGAAGACGGCGACCAGGCGCAGCGCCATG
CCCGGCAACTGGTGGAGGCGCTGGAAGTCCGACGCCTGTCGTTCGCTGGCGAGGGCAGCGTACGGACGCT
GGCGCCCGCCAGCCGCTTCATGCTGACCGGCCATTATGACTACGAGCGAGTGCAAGGAGACGACGAACGC
CGCTTTGTCGTCCTGGCGGTGGCGCATGCGGCCCGCAACAACCTGAACGAGCGCTTCCGCGGCGTCATCG
ATCAATTGCTCGGGACAGGTCAGTCGACTGAGGCGCCAGCCGAAGATGCGTCGGCAGTGGACGTGCCGTT
CTACCGCAATCAATTTACGGTAGTGCCGGCAAAGATCCCCTACCGCCCGCAGCAGCTTGACGGACAAGGG
CGGCAACTCCACCCGCGACCCACCGTCACCGGGGCTCAGACTGCCATCGTCATCGGCACGGACGGTCCCG
TGCATACCGACCGCGACCATCGGGTCATGGTTCAGTTCCACTGGCAGCGCGGGGCCCGCTCGGCCAGCCG
GCTGTCTCATCCCGCGGGCGACGACAACGCCCGCGCCGAAGCCGGTTTGGGCACCTGGGTGCGCGTAGCG
ACCCCGGTTGCCGGCGCAAACTGGGGCGGCGTGGCACTGCCGCGCGTCGGCCAGGAAGTGGTGGTGGAAT
TCCAGCACGGCGACATCGACCGCCCGGTCGTGATCGGCGCCGCCTACAACGGCCGCGGCCAGGCCAGCGC
CCAGTACAACCAGAACCAGACCGGCGCTGCCAACGCCACCGGCAACGCACCAGCGTGGTTCGCCGGCAGC
AACGAGACCGCCGATGGCAAACAGGACGGCAACGGCAAGCCCGACGGCCAGCAAGGCCACGTCCACAATG
CGGTGCTGTCCGGCATCAAGACCCAGGCCCTCGGCCACAGCCAGGACGGTACCGGCGGTTACAACCAGCT
TGTCTTCGACGATACCTCGGGACAAAGCCGCACCCTGCTATCCACCACGCAAGCGGCCTCGGCCCTGACG
CTGGGCCACCACCTTGACCAACGCGACAACGCCCGCCAGGCAGCCCTGGGCCACGGCGCCGCGCTGGAAA
CCGCAGACAGCGGCGCCTTGCGCGGCGGCGCGGGCATGCTGCTGACCGCGCACGGCGCCGGCACCAGTGT
GCCCTTGCTCGACAGCGAGGGCGCTGCAACGCAGGTGGAGGCCAGCACTGAACTGCTGACTTCGCTGGCC
GATGTCGCGCGCAAGCAGAAGGCGGACTTGCCGGACGAGCCGGCTCCAGCCGAACTCCCGGCCATCGCAC
AGCTGAAGCACACCACCGAAGTGCTGCGCCATACGGAAGAAGGGGCCGATGGCAAAGCCAGCGCCACTGC
CTATAACGAGCCTCACCTGCAGGTGTCAGCACCCAAGGGCATCGCCGCAACCACGCCCGCCGATGCGGTG
CTGGTCGCGGGTACGCAGCTGACGGTGGCGGCGCAGAAGGATGCCAATGTGGCGGCGGGTGGGAATCTGT
CGGTGGCGGTGGCCGATGGGCTGAGCTTGTTCACGCATGGCAAGGCTGGGGACGAGTCCGCGGCGGGGAT
TGCCATGCATGCGGCGAGCGGGAAGGTGGGTGTTGCCAGCTTGCAGGGCCAGGGTCGCATTGCCGCCGAA
AAGCGGGTGACGGTGTCCTCGTCTCAGGGGGCGGTCAATGTGCAAGCGAAGGAGCATGTGCTGTTGAACG
CGGCCGGGGCCCAGATCCGGGTGCTTGGGAACACGATTGAGGTGCATGCGCCGGGGATGACTACGTTTAA
GGGGGCGCAGCATTTGTTTGTGGGGCCGGGGGGGCGTGAAGCAAATACGAGCCTGCCCAAGGGCGAGCTA
CCCTTGTGCGAGTATCAGGCGATGGGGGCTGAATCGACCGGTGCCGGCATCGTTCCGATTCAGTCCTGA
 Primer design

Protein ID: 194291792
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1034
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1085672..1088968 [+]
Producthypothetical protein
NoteTssI
UniProt IDB3R9R7
KEGG IDcti:RALTA_B1034
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.40E-57, Aligned region: 37..359
Phage_GPD [PF05954], Evalue: 7.40E-57, Aligned region: 474..544
DUF2345 [PF10106], Evalue: 1.80E-36, Aligned region: 38..58
DUF2345 [PF10106], Evalue: 1.80E-36, Aligned region: 772..932
T6SS_Vgr [PF13296], Evalue: 2.20E-34, Aligned region: 618..728
Phage_base_V [PF04717], Evalue: 6.10E-19, Aligned region: 458..556
Protein Sequence: 1098 a.a.     [Download]
>gi|194291792|ref|YP_002007699.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MDVTTLYQHLFSAAHRLYALEGEGVLGELAVEAWIGREGVSALAESRIVVVSANADIPLDSLLGQRVTLL
TTLAGGGQSRRTGLIRQAEKLGAYGGLARYRLTVVPWLWLTTQQRNSQVFQNRKLDSIIEAVLQPYAPHA
QWRYAAGAEARIAAIGERAHVAQFRETDYQFLSRLLAEAGLGYTVVEDEEAPSGHAVVIFADSAQLPEDE
ESAAGGGIRFHRAHSQESADAIQQLACETRATVGGVAVTAWDPEAKRAIRGHAPARYVGNAGRAVSPDPY
LSVSLSLAPDGASAQRVAEQVMEAVEARALLFTGRASVRTLRSGMRLTVNGCPHLPLQEDDAAGYPLLLD
AVEHCGINNLAADTRAALADRIGPLEAALCFDAPPAAPDAPEATPGLLGVLPDHEPVRLAPSQALQTAAR
EQGYAAIFRAIDARRPWRACVLDVDCPRLYSRSKPLGVHSAIVVGPDGQSQAHGNAEHHASPAGEICVRF
HWQRGERADDRSSRWIRVAQRQAGAGMGWQWLPRIGQEVLVKFADDDIDQPFVIGALYNGQGEAGHAPTP
GGKSAATGSDSQSLYAQGTDSAPSAQGNLAGGNSPAWHGLGAQPDGHRNAAALTGFKSQEHGGKGYNQLV
LDDSDGQLRTQLATTLQSTQLNLGHLIHQQDNRRGSFRGQGFELRTDGHAAVRGEAGLLLTTYRDAATGR
ALPTGDNAAGIALLRQASDLVKTLSQGATAHQTQALSTGKDGDAPLPKQAQAASGMVDGQALEAARDDAS
SGNTTTPGKVPHQAAAMVHLNGRAGLTLVAGQDLQIANGESVALASGLDSSIAVAGQARVHAGQAIGVAA
GLSGAGDNNIGLQLTAGQNDIDIQAQHDLLKLAARDDLTVVSANMNVDFAAAKRIRIATAGGASILIEGG
NITVECPRAITYKAAQRKFEGPVNTAYPLPEFPQAPMPYKPMEFRMRLANTPGEGGHALAYAPWKIAVGE
APLGLGMVADDELVAHGVTDADGNVVLSQTQQEAVARAYCASPANTWLVYPGPTVRVHVAEQDPAWTDAE
AARHALNAGDFSGGLPQSMSDDNTQQRLRYARDALAAGSSNQIYKKTQ
 
Nucleotide Sequence: 3297 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1085672-1088968 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGATGTAACCACTCTTTACCAGCATCTTTTCAGCGCGGCTCACCGGCTGTATGCCCTGGAAGGTGAGG
GCGTGCTGGGCGAACTCGCCGTCGAAGCCTGGATCGGCCGGGAAGGCGTTTCCGCGCTGGCCGAGTCGCG
CATCGTCGTGGTCAGCGCCAACGCCGATATCCCATTGGACAGCCTGCTTGGCCAGCGGGTCACATTGCTG
ACCACGCTCGCCGGCGGCGGCCAGTCGCGCCGCACCGGCCTTATCCGACAGGCCGAGAAGCTCGGCGCCT
ACGGGGGCCTGGCGCGATATCGCCTGACAGTGGTGCCGTGGCTGTGGCTGACCACGCAGCAGCGCAACAG
CCAGGTGTTCCAGAACCGCAAGCTCGACAGCATCATCGAGGCCGTGCTGCAGCCCTATGCGCCGCACGCG
CAATGGCGCTACGCGGCCGGCGCCGAGGCGCGCATTGCCGCCATCGGCGAGCGTGCCCATGTCGCGCAGT
TCCGCGAAACCGACTACCAGTTCCTGTCGCGCCTGCTGGCAGAGGCCGGCCTGGGCTATACCGTCGTGGA
AGACGAGGAAGCCCCCAGCGGGCATGCGGTGGTGATCTTTGCCGACAGCGCGCAATTGCCGGAAGACGAA
GAATCCGCGGCAGGCGGCGGCATCCGCTTCCATCGCGCGCACAGCCAGGAATCGGCCGATGCCATCCAGC
AGCTGGCGTGCGAGACCCGTGCGACTGTGGGCGGCGTGGCCGTGACGGCATGGGACCCGGAGGCCAAGCG
AGCGATCCGCGGCCACGCGCCGGCACGTTATGTCGGCAATGCCGGCCGGGCGGTGAGCCCGGATCCGTAC
CTGTCCGTCAGCCTGTCATTGGCGCCCGACGGCGCGAGCGCGCAGCGCGTTGCCGAGCAGGTGATGGAAG
CCGTCGAAGCCCGCGCGCTACTGTTCACCGGTCGGGCGTCCGTGCGCACGCTGCGCAGCGGCATGCGCCT
GACCGTCAATGGCTGCCCGCACCTGCCGCTGCAGGAAGACGACGCTGCTGGATATCCGCTGCTGCTCGAT
GCGGTGGAGCATTGCGGCATCAACAACCTGGCCGCCGACACACGCGCTGCGCTGGCGGATCGCATTGGGC
CGCTCGAGGCAGCCTTGTGTTTCGACGCACCCCCAGCGGCACCCGACGCACCGGAGGCAACACCCGGGCT
GCTGGGCGTGCTACCGGACCACGAGCCAGTGCGCCTGGCCCCTTCGCAAGCCCTGCAGACGGCAGCACGC
GAACAGGGCTACGCGGCGATCTTCCGCGCCATCGACGCCCGCCGCCCATGGCGTGCCTGTGTCCTTGACG
TCGATTGTCCGCGTCTTTACAGCCGGTCCAAGCCGTTGGGGGTACACAGCGCGATCGTCGTCGGCCCTGA
CGGCCAGTCCCAGGCCCATGGCAACGCCGAACACCACGCCAGCCCAGCCGGCGAGATCTGCGTGCGCTTC
CACTGGCAGCGCGGCGAGCGCGCCGACGACCGCAGCAGCCGCTGGATCCGCGTCGCACAGCGCCAGGCCG
GCGCCGGCATGGGCTGGCAGTGGCTGCCGCGCATCGGGCAGGAAGTGCTGGTCAAGTTCGCCGACGACGA
CATCGACCAGCCTTTCGTCATCGGCGCGTTGTACAACGGCCAGGGTGAAGCGGGCCACGCACCCACGCCC
GGCGGCAAGAGCGCCGCGACGGGCAGCGACAGTCAGTCCCTGTACGCTCAGGGCACCGACAGCGCCCCCA
GCGCGCAAGGCAACCTCGCCGGGGGCAACAGCCCCGCCTGGCACGGACTGGGCGCGCAGCCAGACGGCCA
TCGCAATGCCGCCGCGCTGACGGGTTTCAAGAGCCAGGAACACGGCGGCAAGGGCTACAACCAGCTGGTG
TTGGACGACAGCGACGGCCAGCTGCGCACGCAACTGGCCACCACGCTGCAGTCGACCCAGCTCAATCTTG
GCCACCTGATCCACCAGCAGGACAACCGCCGTGGCAGCTTCCGCGGCCAGGGCTTCGAGTTGCGCACCGA
CGGCCACGCCGCCGTGCGCGGCGAGGCAGGGCTGCTGCTAACCACCTACCGCGACGCGGCTACCGGCCGT
GCGCTGCCCACCGGCGATAACGCCGCCGGCATCGCGCTGCTGCGGCAGGCGAGCGACCTGGTCAAGACCC
TGAGCCAGGGCGCGACCGCGCACCAGACGCAGGCGCTGTCGACCGGCAAGGATGGCGACGCCCCTTTGCC
GAAGCAGGCCCAGGCTGCGTCCGGCATGGTCGACGGACAAGCGCTGGAAGCGGCCAGGGACGATGCATCC
AGCGGCAACACGACGACTCCCGGCAAGGTTCCGCACCAGGCCGCGGCCATGGTCCACCTCAACGGCCGCG
CCGGGCTGACGCTGGTTGCCGGCCAGGACCTGCAGATTGCCAACGGCGAAAGCGTGGCACTGGCCAGCGG
CCTGGACAGCAGCATCGCGGTAGCTGGCCAGGCCCGCGTACACGCCGGACAGGCCATTGGGGTCGCGGCG
GGCCTGTCGGGCGCTGGGGACAACAATATCGGCCTGCAGCTGACGGCGGGGCAGAATGATATCGATATCC
AGGCGCAGCACGATTTGCTAAAGCTGGCGGCACGGGACGACCTGACCGTGGTGTCGGCCAACATGAACGT
GGATTTCGCCGCGGCGAAACGGATCCGCATTGCCACGGCGGGCGGAGCGTCGATACTGATCGAGGGCGGG
AATATTACGGTGGAGTGCCCACGGGCGATTACTTACAAGGCGGCGCAGAGGAAATTCGAGGGGCCGGTGA
ATACTGCCTACCCGCTCCCCGAATTTCCGCAAGCCCCGATGCCTTACAAGCCCATGGAATTCCGCATGCG
GCTGGCAAATACCCCGGGCGAAGGCGGGCACGCGCTGGCTTACGCGCCCTGGAAGATCGCTGTGGGCGAA
GCGCCGCTGGGACTCGGCATGGTGGCTGACGACGAACTGGTGGCACATGGCGTTACCGACGCGGATGGCA
ACGTGGTACTCAGCCAGACCCAGCAGGAAGCCGTGGCGCGCGCCTATTGCGCCAGTCCAGCCAATACCTG
GTTGGTATATCCCGGGCCGACTGTTCGCGTGCACGTTGCCGAGCAGGATCCGGCCTGGACGGACGCGGAG
GCGGCCCGCCACGCACTCAATGCCGGTGACTTCAGTGGTGGGCTACCGCAATCGATGTCGGATGACAATA
CGCAGCAACGGCTGCGCTATGCCCGCGATGCGCTAGCTGCAGGATCGTCCAACCAGATCTACAAAAAAAC
TCAGTAA
 Primer design