SecReT6
Protein ID: 194291768
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1009
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1053132..1053926 [-]
Producthypothetical protein
NoteTssL
UniProt IDB3R9P3
KEGG IDcti:RALTA_B1009
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.00E-57, Aligned region: 34..235
Protein Sequence: 264 a.a.     [Download]
>gi|194291768|ref|YP_002007675.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MSATSTPSLFGASPAGQPSVAAAGSADGAMHARTLLDLLYDGFFMLFLLRNGQQPGSAEEFLQKVREFLD
DFERGAKRLNVAAEDIFDAKYAFCAAIDETILASNFSIRSTWERRPLQLVLFGEQLAGEGFFSKLEELRA
HGAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDEISAIKGKRAAFAPQWPIPDKISHALKRE
TPLWIFGAVFALIALLAFLGLSTTLRSQTSDTLQGYSQVIKLGPRYSHLTISLP
 
Nucleotide Sequence: 795 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1053926-1053132 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGAGCGCTACTTCCACGCCTTCGCTGTTCGGCGCCTCGCCGGCCGGCCAGCCCTCCGTTGCCGCAGCGG
GCTCCGCCGACGGCGCCATGCACGCCCGCACGTTGCTCGACCTGCTCTACGATGGCTTTTTCATGCTGTT
CCTGCTGCGCAATGGCCAGCAGCCGGGCAGCGCCGAAGAGTTCCTGCAGAAGGTGCGCGAGTTCCTCGAT
GATTTCGAGCGCGGCGCCAAGCGGCTCAACGTGGCGGCCGAAGACATCTTCGATGCCAAGTACGCCTTCT
GCGCCGCCATCGACGAGACCATCCTGGCGTCGAACTTCAGCATCCGCAGCACGTGGGAGCGGCGGCCGCT
GCAACTGGTGCTGTTCGGCGAGCAACTGGCCGGTGAAGGCTTCTTCAGCAAGCTGGAAGAACTGCGCGCG
CACGGCGCGCCGCGCCTGCAGGCGCTGGAAGTCTTCCACATGTGCCTGCTGCTGGGATTCCGCGGCAAGT
ACATCCTGGAAGGGCCCGAGAAGCTGGCCTACCTGACCGCGCGGCTGGGCGACGAGATCTCGGCGATCAA
GGGCAAGCGCGCCGCCTTTGCGCCGCAATGGCCGATCCCGGACAAGATCTCGCACGCGCTCAAGCGAGAA
ACCCCGCTGTGGATCTTCGGCGCGGTCTTTGCATTGATCGCACTGCTGGCCTTCCTGGGGCTGTCGACCA
CGCTGCGCTCGCAGACCAGCGACACGCTGCAAGGCTACTCGCAGGTGATCAAGCTGGGGCCGCGTTATTC
GCACCTGACCATCTCGCTGCCCTGA
 Primer design