SecReT6
Protein ID: 194291769
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1010
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1053923..1055269 [-]
Producthypothetical protein
NoteTssK
UniProt IDB3R9P4
KEGG IDcti:RALTA_B1010
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-134, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|194291769|ref|YP_002007676.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQVIQPYGWGVRNASFDTDALASGVLRVTELALFFP
DGELYSAPQADELPPPVVLDAIPAGTSELTFYLALQPLHDAGGNYRDDAEGSLSSRYVGLQTETSDLFTE
AEPAAITYLKKAVRLVAETEPRDQFISLPVARIRRTATGGFELDETFVAPSLSINASAVLYLRLRRLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANASFAALAHLFHHPELHPERLFQEMLRLAGALMT
FSKSHTLADLPVYDHDSPGPVFARLDSIIRDLLDTVISTRYFSIALDETRPSFHLGRLDSGKIDDKTSFY
LSVSADMPVAELVEAIPSRFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAIEARGALYD
RMLQAQTITIYTPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1055269-1053923 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
GTGAGTTATTCCGCCAAGATTTTGTGGGGTGAAGGCCTGTTCCTGCGGCCCCAGCATTTCCAGCGCCAGG
ACGCATACCATGAGTCGCGCCTGCACGCCACCGCGCAAGTGATCCAGCCCTACGGGTGGGGCGTGCGCAA
TGCCAGTTTTGACACGGATGCGCTTGCCAGCGGTGTGCTGCGCGTGACCGAGCTGGCGCTGTTCTTCCCC
GACGGCGAACTGTATTCCGCGCCCCAGGCCGACGAGCTGCCACCGCCAGTGGTGCTTGACGCGATTCCCG
CCGGCACATCGGAACTCACCTTCTACCTGGCCCTGCAGCCGCTGCACGATGCCGGGGGCAACTACCGCGA
CGATGCGGAAGGATCTCTGTCATCCCGTTATGTCGGCCTGCAGACCGAAACGTCGGACCTTTTCACGGAA
GCCGAGCCAGCCGCCATCACCTATCTGAAGAAGGCGGTGCGGCTGGTGGCCGAGACCGAGCCGCGCGACC
AGTTCATCTCGCTGCCGGTCGCCCGCATCCGGCGCACCGCGACCGGCGGCTTTGAACTGGACGAGACCTT
TGTCGCCCCCAGCCTGTCGATCAATGCGTCGGCCGTGCTGTACCTGCGCCTGCGCCGGCTGATCGATGCG
CTGCAGGCCAAGGTCAATGCGCTGTATGGCTTCCATCGCGAACCCACCAAGAACATCATCGAGTTCCGCT
CGGGCGATATCGCGTCGTTCTGGCTGCTGCACACGGCCAACGCTTCCTTCGCCGCGCTGGCGCACCTGTT
CCATCATCCCGAACTGCATCCCGAGCGGCTGTTCCAGGAAATGCTGCGCCTGGCCGGCGCGCTGATGACC
TTTTCGAAGAGCCACACGCTGGCCGATCTTCCGGTCTACGACCACGACAGTCCGGGCCCGGTCTTCGCGC
GACTGGACAGCATCATCCGCGACCTGCTCGATACCGTCATCTCCACGCGCTACTTTTCGATCGCGCTGGA
CGAGACCCGTCCCTCGTTCCATCTGGGCCGGCTGGATTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTGTCGGTCAGCGCCGACATGCCCGTGGCCGAGCTGGTCGAAGCCATCCCCAGCCGCTTCAAGGTCGGCG
CCCCGGACGATGTGGACAAGCTGGTGCTGTCGTCGATGCCGGGCGTGCCGTTGACGTACACGCCGCAGGT
GCCGCCCGCGATCCCGGTGCGTCCGGGCGCTTGCTATTTCGCGATCGAGGCGCGCGGCGCGCTTTACGAC
CGCATGCTGCAGGCGCAGACCATCACCATCTATACGCCCGCCGGCATCCGGGAACTCAAACTTGAACTGA
TTGCGGTGACCTCATGA
 Primer design