SecReT6
Protein ID: 194291770
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1011
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1055310..1056002 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB3R9P5
KEGG IDcti:RALTA_B1011
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-35, Aligned region: 42..200
Protein Sequence: 230 a.a.     [Download]
>gi|194291770|ref|YP_002007677.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MRQIEFSQGAYSKPGGHGARLAAAAKRVRLAAGLATAVCVSALAGCSVGGTLLAGAASGALEAVGLKPSN
VPESQKPPREVPLKLYAGNNLNAAADNRPAAIVVRLYKLKDPTSFLQAPFDTFIDPQREQKTLGADLVQV
REMTLIPGQRYEIVEKITREAGTFGVVALFRSPAPQRWKFAFDSARSEKSGVTIGLHACAMTLTVGDAIT
PAGAAASSNLNLVSAAGCRT
 
Nucleotide Sequence: 693 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1056002-1055310 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGCGACAAATTGAATTCAGTCAGGGGGCGTACAGCAAGCCAGGCGGGCATGGCGCGCGCCTGGCCGCTG
CGGCGAAGCGAGTCAGGCTGGCTGCTGGCCTGGCAACCGCTGTCTGCGTTTCAGCGCTGGCAGGCTGCTC
GGTCGGCGGCACGCTTCTAGCGGGTGCGGCCAGCGGTGCGCTGGAAGCCGTTGGCCTCAAGCCGTCCAAC
GTGCCGGAATCACAAAAGCCGCCGCGGGAAGTTCCGCTGAAGCTGTACGCCGGCAACAACCTGAATGCGG
CAGCCGACAACCGGCCGGCTGCCATCGTGGTCCGGCTATACAAGCTGAAGGATCCGACCAGCTTCCTGCA
GGCACCGTTCGATACCTTCATCGATCCGCAGCGAGAGCAGAAGACACTCGGCGCTGACCTGGTGCAAGTT
AGAGAGATGACTCTAATTCCAGGCCAGCGTTATGAAATCGTGGAAAAGATCACCCGCGAGGCGGGCACCT
TTGGCGTGGTGGCACTGTTTCGCAGCCCTGCCCCGCAGCGCTGGAAATTCGCGTTCGACAGCGCCAGGAG
CGAAAAGTCCGGCGTGACCATCGGCCTGCACGCCTGCGCCATGACACTGACCGTTGGCGATGCCATCACG
CCGGCGGGCGCCGCGGCCAGCAGCAATCTGAACCTCGTCTCGGCGGCCGGCTGCCGCACCTGA
 Primer design