SecReT6
Protein ID: 194291772
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1013
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1056926..1057441 [+]
Producthypothetical protein
NoteTssB
UniProt IDB3R9P7
KEGG IDcti:RALTA_B1013
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-60, Aligned region: 11..164
Protein Sequence: 171 a.a.     [Download]
>gi|194291772|ref|YP_002007679.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLSGQSEVAQPKLRDRKFVNIDRDNF
DDVMAGIEPRAAFQVPNTLSEEGGKFGVDLKFHSLEDFNPEAVVEQIEPLRKLLEARSKLADLRNKLAGN
DKLEDLLSEVLTNTESLQKLGANARNGGDDA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1056926-1057441 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGCCAAGAAAGAAAGTGTCCAGAAGCGCCTGCAGAAGGTGCGTCCCCCGCGTGTGCAACTGACGTACG
ACGTCGAGAAGGGCGATGCCATCGAGCAGAAGGAGCTGCCCTTTGTCGTGGGCGTGGTGGCTGACCTGTC
GGGCCAGTCGGAAGTGGCGCAGCCCAAGTTGCGCGACCGCAAGTTCGTCAATATCGACCGTGACAACTTT
GACGACGTGATGGCCGGCATCGAGCCGCGCGCCGCATTCCAGGTGCCGAACACGCTCTCCGAGGAAGGAG
GCAAGTTTGGCGTGGACCTGAAGTTCCATTCCCTCGAAGACTTCAATCCGGAAGCGGTGGTCGAGCAGAT
CGAGCCGCTGCGCAAGCTGCTCGAAGCCCGCTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCAGGCAAC
GACAAGCTGGAAGACCTGCTTTCGGAAGTGCTGACCAATACCGAGTCGCTGCAAAAGCTCGGTGCCAATG
CCAGGAACGGTGGCGACGATGCTTGA
 Primer design