SecReT6
Protein ID: 194291773
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1014
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1057434..1058924 [+]
Producthypothetical protein
NoteTssC
UniProt IDB3R9P8
KEGG IDcti:RALTA_B1014
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.50E-193, Aligned region: 68..491
Protein Sequence: 496 a.a.     [Download]
>gi|194291773|ref|YP_002007680.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MLDNQSAAVAQPGVAVGTLNLLDEIVEQSKVAKSDAEHARAKDIIGELVSQVLDGTVVVSDNLSATLDAR
VAELDRLISSQLSAVMHAPEFQKLESTWRGLSYLVKETQTGTMIKIKALNATKRDLVRDFKTAIDFDQSA
LFKKVYEEEFGTFGGAPFGALIGDYEITRQPEDVYFIEQMSHVASASHAPFIASASPELLGLETFADLGK
PRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHGKYLWCN
AAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYNTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ESFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRLVADL
PKAANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1057434-1058924 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGCTTGATAACCAGTCCGCTGCAGTGGCCCAGCCCGGCGTGGCTGTCGGCACGTTGAACCTGCTCGACG
AGATCGTCGAGCAAAGCAAAGTCGCGAAGTCCGATGCCGAGCATGCGCGTGCCAAGGATATCATCGGCGA
GCTGGTCAGCCAGGTGCTGGACGGCACCGTGGTGGTGTCCGACAACCTGTCGGCGACGCTGGATGCGCGC
GTGGCGGAGCTCGATCGCCTGATCTCGTCCCAGCTCAGCGCCGTGATGCATGCGCCGGAGTTCCAGAAGC
TGGAGAGCACGTGGCGCGGCCTGTCGTACCTGGTCAAGGAGACGCAGACCGGCACGATGATCAAGATCAA
GGCCTTGAACGCAACCAAGCGCGACCTGGTGCGCGACTTCAAGACCGCCATCGACTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTATGAAGAAGAGTTCGGCACCTTTGGCGGCGCCCCGTTTGGCGCGCTGATCGGCG
ACTACGAAATCACGCGCCAGCCCGAGGACGTGTATTTCATCGAGCAGATGTCGCACGTGGCTTCGGCCTC
GCACGCTCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTGGGCCTGGAGACCTTCGCCGATCTTGGCAAG
CCGCGCGATCTGGCCAAGGTGTTCGATACCGTCGAATATGCCAAGTGGAAGTCGTTCCGCGAATCCGAGG
ATTCGCGCTACGTCGGCCTGACCATGCCGCGTTTCCTGGGGCGCCTGCCGTACAACCCGAAGGATGGCAC
CACGGTCGAGGGCTTCAACTTCGTCGAGGACGTGGACGGCACCGATCATGGCAAGTATCTGTGGTGCAAC
GCCGCCTGGGCCTTTGGCGCGCGGCTGACCGCCGCCTTTGAGGATTTCGGCTGGTGCGCGGCCATTCGCG
GCGTCGAAGGCGGCGGCCTGGTCGAGGACCTGCCGACGCATACCTTCAAGACCGACGATGGCGAGATTGC
ACTCAAGTGCCCGACCGAAATTGCCATTACGGACCGGCGCGAGAAAGAGCTGAGCGACCTCGGCTTTATC
CCGCTGGTGCACTGCAAGAACTCGGACTATGCCGCATTCTTCGCCGCCCAATCGGTGCAGAAGCCGAAGA
AGTACAACACCGACAGCGCCAATGCCAATGCGGTGCTGTCCGCACAGCTGCAATACATCTTCTCGGTGTC
GCGCGTGGCGCATTACCTGAAGGCCATGATGCGCGACAAGATCGGCAGCTTTGCTTCAGCGCAGAACGTG
GAGAGCTTCCTGAACCGCTGGATCTCGCAATACGTTTTGCTGGATGACAACGCCAGCCAGGAGCAGAAGG
CGCAATTCCCGCTGCGGGAAGCCTCGATCCAGGTGTCGGAGGTACCCGGCAAGCCGGGCACCTACCGCTC
CGTCGCCTTCCTGCGCCCGCACTTCCAGCTTGATGAGCTGTCCATCTCGCTGCGGCTGGTTGCGGATTTG
CCCAAAGCGGCAAACTCCTGA
 Primer design