SecReT6
Protein ID: 194291775
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1016
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1059583..1060056 [+]
Producthypothetical protein
NoteTssE
UniProt IDB3R9Q0
KEGG IDcti:RALTA_B1016
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.10E-21, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|194291775|ref|YP_002007682.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MKGFEPSLLDKLFDDEPHAPLPSALRQLSLEELKATVARDIESLLNTRIVHEDADFNGLPECRRSLLTYG
LNDFAGLSLASFDDRQYICQSLRNAIERHEPRLQNVNVALSVNERATSVLCFGISAVLLVGPAREPVSFD
AMLQPSTLQYSVTRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1059583-1060056 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGAAAGGCTTTGAGCCCAGCCTGCTCGACAAGCTCTTCGACGACGAGCCGCATGCGCCGCTGCCCAGTG
CGCTGCGGCAATTGTCGCTGGAAGAACTGAAGGCGACGGTTGCCCGCGACATCGAATCGCTGCTGAACAC
GCGCATCGTCCATGAGGACGCCGATTTCAACGGCTTGCCCGAATGCCGCCGGTCTCTGCTGACCTATGGG
CTCAACGACTTCGCGGGGCTGAGCCTGGCCAGCTTCGATGACCGCCAGTACATCTGCCAGTCGTTGCGCA
ATGCGATCGAGCGCCATGAGCCGCGCTTGCAGAACGTCAACGTCGCGCTGTCGGTCAACGAGCGGGCTAC
CAGCGTGCTGTGCTTTGGCATCAGCGCGGTGCTGCTGGTCGGACCCGCGCGCGAGCCGGTCAGCTTCGAT
GCCATGTTGCAGCCATCGACGCTGCAGTATTCGGTCACCCGAGGGCGGGGCTGA
 Primer design