SecReT6
Protein ID: 194291776
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1017
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1060152..1061990 [+]
Producthypothetical protein
NoteTssF
UniProt IDB3R9Q1
KEGG IDcti:RALTA_B1017
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-207, Aligned region: 2..611
Protein Sequence: 612 a.a.     [Download]
>gi|194291776|ref|YP_002007683.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MLPYYERELAFLRRYSRDFAERYPKIAARLAMSADGCDDPHVERMIESFAFLSARISKKLDDEYPEFTEA
LLEVLYPHYLSPFPSCSIAHFDVAGMAAQLSAPVTVPRGTLLTTRPVRKVECRFRTAYDVTFLPLRVAAA
GFERAVSAPSTVALPKGATGAISIELEYLGEQGGFDALGRQAVRVYLDGEPSFVAALGDALFLHVAAAYV
EERPGVWKRLQRVPLREVGFGADEALIDTPARSHPAYRLLSEHFGFAEKFNFFDLDLDPVQRALLPGSAV
RRVTLHLVLTDVRSDSNTARLLEGLGAAHLRLHCTPVVNLFRQKADPIRIEHTATAYPVVADSRRAHGFE
VYSIDQVQLVRETAASHDVVEFRPFYSLHHGEDPGSAGHYWIARRNALVAERSPGFETEISIVDSDFDPA
SPRTETLSLSVTCTNRDLPALLAFGQPDGDLTMEGSSIARRISFLRKPTSSMRLSSGRSSQWRLVSLLAL
NHLSLVQNGLATLKEMLRLHDLPRSAISARQIEGIVGLDYKPTTQWLAGKPFATFVRGLEIQLTLDEDAF
VGTGLHRFIRVMDHFFGLYVHLNSFVQLVAVSRRGGKELARCAPRSGESILV
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1060152-1061990 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
TTGCTGCCATATTACGAACGCGAACTGGCCTTCCTGCGCCGGTATTCGCGCGACTTTGCCGAGCGCTATC
CCAAGATTGCGGCGCGCCTGGCAATGTCGGCCGATGGCTGCGACGACCCCCACGTCGAGCGGATGATCGA
ATCGTTCGCCTTCCTGTCCGCACGCATCAGCAAGAAGCTCGACGACGAGTACCCCGAATTCACCGAAGCG
CTGCTGGAGGTGCTGTACCCGCACTACCTGAGCCCGTTTCCGTCCTGCTCGATTGCGCATTTCGACGTGG
CCGGCATGGCCGCGCAGTTGAGCGCGCCGGTCACGGTGCCGCGCGGCACGTTGCTGACCACGCGCCCGGT
GCGCAAGGTGGAGTGCCGTTTCCGAACGGCCTATGACGTGACCTTCCTGCCGTTGCGGGTCGCTGCCGCG
GGCTTTGAGCGGGCGGTGTCCGCGCCGTCGACGGTGGCCTTGCCGAAGGGAGCCACGGGCGCCATCTCGA
TCGAACTGGAGTACCTGGGCGAGCAGGGCGGCTTCGATGCACTGGGCCGCCAGGCGGTGCGCGTCTACCT
GGATGGCGAGCCGTCATTCGTTGCGGCCCTGGGCGACGCGCTATTCCTGCACGTGGCCGCGGCGTATGTG
GAAGAGCGCCCCGGTGTGTGGAAGCGCCTGCAGCGGGTGCCGCTGCGCGAGGTGGGTTTCGGCGCGGACG
AGGCGCTGATTGACACCCCCGCGCGCTCGCATCCGGCATACCGCCTGCTGAGCGAGCATTTCGGCTTTGC
CGAGAAATTCAACTTCTTCGATCTCGACCTGGACCCGGTTCAGCGGGCGCTGTTGCCCGGCAGCGCCGTG
CGCCGCGTGACGCTGCACCTGGTACTGACAGACGTGCGCAGCGACAGCAACACCGCGCGCCTGCTCGAAG
GGCTTGGCGCTGCTCACCTGCGCCTGCATTGCACGCCGGTGGTCAACCTGTTCCGGCAAAAGGCCGACCC
GATCCGCATCGAGCATACCGCCACCGCTTATCCGGTGGTGGCCGACAGCCGCCGCGCACACGGTTTCGAG
GTTTATTCGATCGACCAGGTGCAACTGGTGCGCGAAACCGCCGCCAGCCACGACGTGGTGGAGTTCCGGC
CGTTCTACTCCCTGCACCATGGCGAAGATCCGGGCAGCGCCGGCCACTACTGGATCGCCCGCCGCAATGC
CCTGGTAGCGGAACGCAGCCCGGGCTTCGAGACCGAAATCTCCATCGTCGATTCGGACTTCGATCCCGCC
AGCCCACGCACGGAAACGCTGAGCCTGAGCGTTACCTGCACCAACCGCGACCTGCCCGCGCTGCTGGCGT
TCGGTCAGCCCGATGGCGACTTGACCATGGAGGGCAGCTCGATCGCTCGCCGCATCAGCTTCCTGCGCAA
GCCGACGTCGTCGATGCGGCTGAGCAGCGGGCGCTCGTCGCAGTGGCGGCTGGTTTCGCTGCTGGCGCTG
AATCACCTGTCCCTGGTGCAGAACGGCCTCGCCACGCTCAAGGAAATGCTGCGCCTGCATGACCTGCCGC
GCAGCGCGATTTCGGCGCGGCAGATCGAAGGCATCGTTGGCCTGGACTACAAGCCCACCACGCAGTGGCT
GGCTGGCAAGCCGTTCGCCACCTTTGTGCGCGGGCTGGAGATCCAGCTGACGCTGGACGAGGATGCCTTC
GTCGGCACCGGCCTGCATCGCTTTATCCGGGTCATGGATCATTTCTTTGGCCTCTATGTCCACCTGAACA
GCTTTGTGCAGCTGGTCGCGGTATCGCGCCGCGGCGGCAAGGAACTGGCAAGATGCGCACCCCGCAGCGG
CGAATCGATCCTGGTGTAA
 Primer design