SecReT6
Protein ID: 194291777
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1018
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1061954..1063045 [+]
Producthypothetical protein
NoteTssG
UniProt IDB3R9Q2
KEGG IDcti:RALTA_B1018
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-92, Aligned region: 18..344
Protein Sequence: 363 a.a.     [Download]
>gi|194291777|ref|YP_002007684.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MRTPQRRIDPGVIRTLLRQPYRYEFFQAVRLLELHYAREGAGTPEQVLATRVAFRNTLSLSFPPSELQSI
EAATALNGELDSDAAFAQALADGALDQVSITPTFFGMLGGQGALPLHYTEIVAERETLRRDRAARAFFDI
FSNRATALFYQAWKKYRLPFQHEVDRNRHYLPLLLSLAGMADKSMRRGLSATAGVVHDEALAGYATAVRH
RPVSAAYLQQVLSDYFQAEVRVEQFVGGWYQVPPSQYSRLGGSNNLLGATALAGARVWQRDLRVRVWMGP
LGREQYRNFLPGAEGALALRKMVTVLCGATLEYEVGLILRASDVSGCALGAAGSGRLGWDTFLSTRPARQ
DRSDARYTLAPVH
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1061954-1063045 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGCGCACCCCGCAGCGGCGAATCGATCCTGGTGTAATCCGCACACTGCTGCGGCAACCCTACCGCTATG
AGTTCTTCCAGGCGGTGCGGTTGCTCGAGCTGCACTATGCGCGCGAAGGCGCCGGCACGCCGGAGCAGGT
GCTGGCCACGCGCGTCGCCTTCCGCAACACCCTGTCGCTGTCATTCCCGCCGAGCGAGCTGCAGTCCATC
GAGGCCGCCACCGCGCTGAATGGCGAACTGGATAGCGATGCAGCCTTTGCGCAAGCCCTGGCCGATGGTG
CGCTGGACCAGGTGTCGATCACGCCCACCTTTTTCGGGATGCTGGGCGGGCAGGGGGCGCTGCCTCTGCA
CTACACCGAGATCGTGGCGGAGCGCGAAACCCTGCGCCGCGACCGCGCCGCACGCGCCTTCTTCGATATC
TTTTCCAATCGCGCCACCGCGCTGTTCTATCAGGCGTGGAAAAAGTACCGGCTGCCGTTCCAGCACGAAG
TCGACCGCAACCGGCACTACCTGCCACTGCTGCTGTCGCTGGCCGGCATGGCGGACAAGTCCATGCGGCG
CGGCCTGTCAGCCACAGCCGGGGTCGTGCATGATGAAGCGCTGGCCGGATATGCCACCGCCGTGCGCCAC
CGGCCGGTATCGGCCGCCTATTTGCAGCAGGTGCTGTCCGACTACTTCCAGGCTGAAGTACGCGTCGAGC
AGTTCGTCGGCGGCTGGTACCAGGTGCCGCCGTCACAGTATTCGCGGCTTGGCGGTTCGAACAACCTGTT
GGGCGCCACCGCACTGGCCGGGGCCCGCGTCTGGCAGCGGGACCTGCGCGTGCGAGTCTGGATGGGACCG
CTGGGTCGCGAGCAGTATCGCAATTTCCTCCCTGGCGCCGAAGGGGCGCTGGCCCTTCGGAAGATGGTGA
CGGTTCTGTGCGGCGCCACGCTGGAGTACGAAGTCGGCCTGATCTTGCGCGCCAGCGACGTATCCGGCTG
CGCGCTCGGCGCCGCGGGCAGCGGCAGGCTTGGCTGGGATACTTTCCTCAGCACGAGGCCCGCGCGCCAG
GACCGCAGCGATGCGCGCTACACGCTTGCGCCCGTGCACTGA
 Primer design