SecReT6
Protein ID: 194291778
SecReT6 ID267
T6SS typei4b
Gene symbolclpB2
Locus tagRALTA_B1019
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1063126..1065855 [+]
Productchaperone clpb
NoteTssH
UniProt IDB3R9Q3
KEGG IDcti:RALTA_B1019
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-44, Aligned region: 231..330
AAA_2 [PF07724], Evalue: 1.60E-44, Aligned region: 639..806
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 232..344
AAA [PF00004], Evalue: 9.80E-21, Aligned region: 644..762
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 232..255
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 644..762
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 277..310
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 445..508
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 623..682
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 709..732
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 806..850
ClpB_D2-small [PF10431], Evalue: 7.80E-12, Aligned region: 386..403
ClpB_D2-small [PF10431], Evalue: 7.80E-12, Aligned region: 816..887
Clp_N [PF02861], Evalue: 4.60E-10, Aligned region: 23..74
Clp_N [PF02861], Evalue: 4.60E-10, Aligned region: 113..127
Clp_N [PF02861], Evalue: 4.60E-10, Aligned region: 445..461
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 640..664
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 705..737
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 211..250
Sigma54_activat [PF00158], Evalue: 1.40E-06, Aligned region: 641..743
AAA_17 [PF13207], Evalue: 3.20E-06, Aligned region: 125..226
AAA_17 [PF13207], Evalue: 3.20E-06, Aligned region: 232..280
AAA_17 [PF13207], Evalue: 3.20E-06, Aligned region: 643..679
Arch_ATPase [PF01637], Evalue: 5.10E-05, Aligned region: 211..251
Arch_ATPase [PF01637], Evalue: 5.10E-05, Aligned region: 284..370
Arch_ATPase [PF01637], Evalue: 5.10E-05, Aligned region: 640..681
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 639..668
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 232..366
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 642..724
IstB_IS21 [PF01695], Evalue: 0.00021, Aligned region: 216..251
IstB_IS21 [PF01695], Evalue: 0.00021, Aligned region: 643..661
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 228..305
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 357..406
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 475..509
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 638..661
NACHT [PF05729], Evalue: 0.00026, Aligned region: 232..329
NACHT [PF05729], Evalue: 0.00026, Aligned region: 644..664
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 232..255
AAA_18 [PF13238], Evalue: 0.00034, Aligned region: 645..673
T2SE [PF00437], Evalue: 0.0015, Aligned region: 214..252
T2SE [PF00437], Evalue: 0.0015, Aligned region: 632..680
AAA_19 [PF13245], Evalue: 0.0022, Aligned region: 232..253
AAA_19 [PF13245], Evalue: 0.0022, Aligned region: 499..515
AAA_19 [PF13245], Evalue: 0.0022, Aligned region: 639..665
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 227..251
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 499..563
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 641..655
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 644..665
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 740..762
Zeta_toxin [PF06414], Evalue: 0.0057, Aligned region: 232..252
Zeta_toxin [PF06414], Evalue: 0.0057, Aligned region: 635..683
Protein Sequence: 909 a.a.     [Download]
>gi|194291778|ref|YP_002007685.1| clpB2 gene product [Cupriavidus taiwanensis LMG 19424]
MAIPLKTLIAKLNASCRHAAERAASLCMARGNYEVDLEHLFLALLENARSDFSVAVRASGIDPSALQRDL
EAEITRFKDGNTRTPAFSPYLPKLFEHAWLIASLDSQTTRIRSGHLLLALLTEPALAPLAVRGSHRFAEF
DADRLKHDFDKLTAGSEEREQAVDMADGSAATASANGVTAAPALTATPALDQFTVDLTQSARDGRIDPVI
GRDAEIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGLAQRIAVGDVPPPLQGVTVRTLDMGLLQAGASV
KGEFENRLKNVIEEVRKSPQPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVDEPSETLAAAMLRGMVPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQNATPGAIEDDRKALERLGVELAALQREQRAGAAHTERLAALEAQRAELEQRVAAAD
ARLAQERELVARIQALRAAREQGNDAETEAAAPAMAANSDVVAMPRKGSRKAAAVASEPDELDQLLAELR
ALQGEAPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALDAIAQRVRTAT
ANLEDPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGE
GGVLTEAVRRNPYSVVLLDEIEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSVIMQA
CLNNAAEELPDADALAEVLRPTLYKAFKPAFLGRTKVVPYYPIPDDVLVEIITLKLGRIRDRVAANHQAE
FQWDNALVEAVLARCTEVDAGARAVDHILNGTLLPEIAQTVLVRMAEGGGVDKIKVTTGKNGEFKYRIS
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1063126-1065855 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGCCATTCCCCTCAAGACGTTGATCGCCAAACTGAATGCAAGCTGCCGGCACGCCGCGGAGCGCGCCG
CGTCGCTGTGCATGGCGCGCGGCAACTATGAGGTCGACCTGGAGCACCTGTTCCTGGCGCTACTGGAAAA
CGCGCGCAGCGATTTCTCGGTGGCGGTGCGCGCCAGCGGCATCGATCCCTCGGCGCTGCAGCGCGACCTG
GAAGCGGAAATCACGCGCTTCAAGGACGGCAACACGCGAACGCCGGCTTTTTCGCCTTATCTGCCGAAGC
TGTTCGAACATGCGTGGCTGATTGCGTCGCTCGACTCCCAGACCACCCGCATCCGATCCGGCCACCTGCT
GCTGGCCTTGCTGACGGAGCCGGCGCTGGCGCCGCTGGCAGTACGCGGCTCGCATCGCTTTGCCGAGTTT
GATGCGGATCGCCTCAAGCATGATTTCGACAAACTGACCGCCGGTTCCGAAGAGCGGGAGCAGGCGGTGG
ATATGGCTGATGGCAGCGCGGCAACGGCAAGCGCCAACGGCGTTACCGCGGCGCCCGCGCTGACCGCGAC
GCCGGCGCTCGACCAGTTCACTGTCGACCTGACCCAATCCGCCCGCGATGGCCGCATCGACCCGGTGATC
GGGCGCGATGCCGAGATCCGCCAGGTCATCGACATCCTGATGCGGCGCCGGCAGAACAACCCGATCCTGA
CCGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTCGAAGGCCTTGCGCAGCGTATTGCGGTGGGCGACGT
GCCGCCGCCGCTGCAAGGCGTGACCGTGCGTACGCTCGACATGGGGCTGCTGCAGGCCGGTGCCAGCGTC
AAAGGCGAATTCGAGAATCGGCTGAAGAACGTGATCGAGGAAGTCCGCAAGAGCCCGCAGCCCATCATCC
TGTTTATCGACGAGGCCCATACCATCATCGGCGCGGGCGGCCAGGCCGGGCAGAACGATGCCGCCAACCT
GCTCAAGCCGGCGCTGGCGCGCGGCGAGCTGCGGACCATCGCCGCGACGACCTGGAGCGAGTATAAAAAG
TACTTCGAAAAGGACGCCGCGCTGGCGCGGCGCTTCCAGGTGGTCAAGGTGGATGAGCCCAGCGAGACGC
TGGCCGCTGCGATGCTGCGCGGCATGGTGCCGCTGATGGAGCGCCATTTCGGCGTGCGCGTGCTGGACGA
AGCTATCACCGAGGCTGTGCGCCTGTCGCATCGCTACATCAGCGGCCGCCAGCTGCCGGACAAGGCGGTC
AGCGTGCTCGATACCGCTTGCGCCAAGGTGGCGCTGGGGCAGAACGCCACGCCAGGTGCGATCGAGGACG
ATCGCAAGGCGCTGGAACGCTTGGGCGTGGAGCTGGCTGCGCTGCAGCGGGAGCAACGCGCTGGGGCGGC
GCACACAGAGCGCCTGGCAGCGCTGGAAGCACAGCGTGCCGAACTGGAACAACGCGTGGCCGCCGCCGAT
GCGCGCCTGGCGCAGGAGCGCGAACTGGTGGCGCGCATCCAGGCACTGCGTGCGGCACGAGAGCAGGGCA
ACGATGCGGAGACGGAAGCAGCCGCCCCGGCCATGGCAGCCAACAGCGATGTGGTGGCAATGCCGCGCAA
GGGCAGCCGCAAGGCAGCCGCTGTGGCTTCGGAGCCCGACGAACTCGACCAGCTGCTGGCGGAGCTTCGT
GCGCTCCAGGGTGAAGCACCGATGGTGCCGTTGCAGGTAGACGGCCACGTGGTTTCCGAGATCGTATCGG
CATGGACAGGGATTCCGCTCGGCCGCATGGTCAAGGATGAGCTGCGCACGGTGCTGAACCTGAAGCCCTT
GCTGGCCGCGCGCGTGATCGGCCAGGACCATGCGCTGGATGCAATCGCCCAGCGCGTGCGCACCGCCACC
GCGAACCTGGAAGATCCCAACAAGCCGCGCGGCGTGTTCCTGTTCGCAGGCCCGTCCGGCGTCGGCAAGA
CCGAAACCGCGCTGGCGCTGGCAGACATCCTCTACGGTGGCGAACGCAAGCTCATCACCATCAACATGAG
CGAGTACCAGGAAGCGCACAGCGTGTCGGGGCTGAAGGGATCGCCGCCAGGCTATGTCGGTTATGGCGAG
GGCGGCGTGCTGACCGAGGCCGTGCGCCGCAACCCTTACAGCGTGGTGCTGCTGGACGAGATCGAGAAGG
CCCACCCGGATGTGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGATGCCGAGGGGCG
GCCCATCGACTTCCGCAACACCATCATCATCCTGACGTCGAATGTCGGCTCGTCGGTGATCATGCAGGCC
TGCCTGAACAACGCCGCAGAGGAACTGCCTGACGCCGACGCCCTGGCCGAGGTGCTACGACCGACACTGT
ACAAAGCCTTCAAGCCGGCCTTCCTGGGGCGTACCAAGGTCGTGCCGTACTACCCGATTCCGGACGACGT
GCTGGTGGAGATCATCACGCTCAAGCTCGGTCGCATCCGCGACCGTGTAGCCGCCAACCACCAAGCGGAA
TTCCAGTGGGATAACGCGCTGGTCGAGGCGGTGCTGGCGCGCTGCACCGAAGTCGATGCCGGTGCGCGTG
CGGTCGACCATATCCTGAACGGAACGCTGCTTCCGGAGATCGCGCAAACCGTACTGGTGCGCATGGCAGA
GGGCGGCGGTGTCGACAAGATCAAGGTCACCACGGGCAAGAACGGTGAGTTCAAGTACCGCATCAGCTGA
 Primer design