SecReT6
Protein ID: 194291779
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1020
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1065896..1068694 [+]
Producthypothetical protein
NoteTssI
UniProt IDB3R9Q4
KEGG IDcti:RALTA_B1020
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-72, Aligned region: 42..364
Phage_GPD [PF05954], Evalue: 2.70E-72, Aligned region: 532..558
Phage_GPD [PF05954], Evalue: 2.70E-72, Aligned region: 674..731
DUF2345 [PF10106], Evalue: 2.10E-40, Aligned region: 740..897
T6SS_Vgr [PF13296], Evalue: 1.20E-26, Aligned region: 598..703
Phage_base_V [PF04717], Evalue: 2.60E-18, Aligned region: 431..535
Protein Sequence: 932 a.a.     [Download]
>gi|194291779|ref|YP_002007686.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MVAATDLAKLLGAAFSQANRLLRLQTPLGHDALMPEQLQAAEQLDGGGFRIDLTAVSDNAGIEAQSLLGQ
AVRIDLLTQRSRTTLRPFHGHVTRFERVGANGGLARYRIVVEPWLALLRHRRDSFLFQDMSVVDVVDSVF
GDYNGQGKLVPAWRWALRDASAYPRRSIVTQYEESDFDFVTRLLAEEGLFYYFEHEAADGEALGTHRMVI
ADANDVFQDNEQASIRFGRADATAAEDVIDRWQGARRLQTNTVAVASWDYRAKAVRSAEAGAPAEGNSAA
PTLQDTDYPGQYWFEDGDQAQRHARQLVEALEVRRLSFAGEGSVRTLAPASRFMLTGHYDYERVQGDDER
RFVVLAVAHAARNNLNERFRGVIDQLLGTGQSTEAPAEDASAVDVPFYRNQFTVVPAKIPYRPQQLDGQG
RQLHPRPTVTGAQTAIVIGTDGPVHTDRDHRVMVQFHWQRGARSASRLSHPAGDDNARAEAGLGTWVRVA
TPVAGANWGGVALPRVGQEVVVEFQHGDIDRPVVIGAAYNGRGQASAQYNQNQTGAANATGNAPAWFAGS
NETADGKQDGNGKPDGQQGHVHNAVLSGIKTQALGHSQDGTGGYNQLVFDDTSGQSRTLLSTTQAASALT
LGHHLDQRDNARQAALGHGAALETADSGALRGGAGMLLTAHGAGTSVPLLDSEGAATQVEASTELLTSLA
DVARKQKADLPDEPAPAELPAIAQLKHTTEVLRHTEEGADGKASATAYNEPHLQVSAPKGIAATTPADAV
LVAGTQLTVAAQKDANVAAGGNLSVAVADGLSLFTHGKAGDESAAGIAMHAASGKVGVASLQGQGRIAAE
KRVTVSSSQGAVNVQAKEHVLLNAAGAQIRVLGNTIEVHAPGMTTFKGAQHLFVGPGGREANTSLPKGEL
PLCEYQAMGAESTGAGIVPIQS
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1065896-1068694 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGTTGCAGCGACCGACCTGGCCAAACTGCTTGGCGCCGCTTTCTCGCAGGCCAACCGCTTGCTGCGCC
TGCAGACGCCCCTTGGGCACGACGCGCTGATGCCCGAGCAGCTGCAGGCGGCAGAGCAGCTGGACGGCGG
CGGGTTCCGCATCGACCTGACGGCGGTGTCGGATAACGCCGGCATCGAGGCGCAAAGCCTTCTGGGCCAG
GCCGTGCGCATCGACCTGCTGACCCAGCGCAGCCGCACCACGTTGCGGCCCTTCCATGGCCACGTCACGC
GCTTCGAGCGCGTGGGCGCCAACGGCGGGCTGGCGCGCTACCGGATCGTGGTGGAGCCTTGGCTGGCCCT
CCTGCGCCACCGCCGCGACAGCTTCCTGTTCCAGGACATGTCGGTGGTCGACGTGGTGGACAGCGTGTTC
GGCGACTACAACGGCCAGGGCAAGCTGGTGCCGGCGTGGCGCTGGGCGCTGCGCGACGCGTCGGCCTATC
CGCGCCGCAGCATCGTCACGCAGTACGAAGAGAGCGACTTCGACTTCGTGACGCGGCTGCTCGCCGAAGA
AGGCTTGTTCTACTACTTCGAGCATGAAGCCGCGGATGGCGAGGCACTCGGCACGCACCGCATGGTGATC
GCCGATGCCAACGATGTCTTCCAGGACAACGAACAAGCCAGCATCCGCTTCGGCCGCGCCGATGCCACCG
CTGCCGAAGACGTGATCGATCGCTGGCAAGGTGCGCGCAGGCTGCAGACCAATACTGTGGCCGTGGCCAG
CTGGGACTATCGCGCCAAGGCGGTGCGCAGCGCCGAGGCCGGTGCGCCGGCCGAGGGCAATTCAGCCGCT
CCGACCCTGCAGGATACCGACTATCCCGGCCAATACTGGTTCGAAGACGGCGACCAGGCGCAGCGCCATG
CCCGGCAACTGGTGGAGGCGCTGGAAGTCCGACGCCTGTCGTTCGCTGGCGAGGGCAGCGTACGGACGCT
GGCGCCCGCCAGCCGCTTCATGCTGACCGGCCATTATGACTACGAGCGAGTGCAAGGAGACGACGAACGC
CGCTTTGTCGTCCTGGCGGTGGCGCATGCGGCCCGCAACAACCTGAACGAGCGCTTCCGCGGCGTCATCG
ATCAATTGCTCGGGACAGGTCAGTCGACTGAGGCGCCAGCCGAAGATGCGTCGGCAGTGGACGTGCCGTT
CTACCGCAATCAATTTACGGTAGTGCCGGCAAAGATCCCCTACCGCCCGCAGCAGCTTGACGGACAAGGG
CGGCAACTCCACCCGCGACCCACCGTCACCGGGGCTCAGACTGCCATCGTCATCGGCACGGACGGTCCCG
TGCATACCGACCGCGACCATCGGGTCATGGTTCAGTTCCACTGGCAGCGCGGGGCCCGCTCGGCCAGCCG
GCTGTCTCATCCCGCGGGCGACGACAACGCCCGCGCCGAAGCCGGTTTGGGCACCTGGGTGCGCGTAGCG
ACCCCGGTTGCCGGCGCAAACTGGGGCGGCGTGGCACTGCCGCGCGTCGGCCAGGAAGTGGTGGTGGAAT
TCCAGCACGGCGACATCGACCGCCCGGTCGTGATCGGCGCCGCCTACAACGGCCGCGGCCAGGCCAGCGC
CCAGTACAACCAGAACCAGACCGGCGCTGCCAACGCCACCGGCAACGCACCAGCGTGGTTCGCCGGCAGC
AACGAGACCGCCGATGGCAAACAGGACGGCAACGGCAAGCCCGACGGCCAGCAAGGCCACGTCCACAATG
CGGTGCTGTCCGGCATCAAGACCCAGGCCCTCGGCCACAGCCAGGACGGTACCGGCGGTTACAACCAGCT
TGTCTTCGACGATACCTCGGGACAAAGCCGCACCCTGCTATCCACCACGCAAGCGGCCTCGGCCCTGACG
CTGGGCCACCACCTTGACCAACGCGACAACGCCCGCCAGGCAGCCCTGGGCCACGGCGCCGCGCTGGAAA
CCGCAGACAGCGGCGCCTTGCGCGGCGGCGCGGGCATGCTGCTGACCGCGCACGGCGCCGGCACCAGTGT
GCCCTTGCTCGACAGCGAGGGCGCTGCAACGCAGGTGGAGGCCAGCACTGAACTGCTGACTTCGCTGGCC
GATGTCGCGCGCAAGCAGAAGGCGGACTTGCCGGACGAGCCGGCTCCAGCCGAACTCCCGGCCATCGCAC
AGCTGAAGCACACCACCGAAGTGCTGCGCCATACGGAAGAAGGGGCCGATGGCAAAGCCAGCGCCACTGC
CTATAACGAGCCTCACCTGCAGGTGTCAGCACCCAAGGGCATCGCCGCAACCACGCCCGCCGATGCGGTG
CTGGTCGCGGGTACGCAGCTGACGGTGGCGGCGCAGAAGGATGCCAATGTGGCGGCGGGTGGGAATCTGT
CGGTGGCGGTGGCCGATGGGCTGAGCTTGTTCACGCATGGCAAGGCTGGGGACGAGTCCGCGGCGGGGAT
TGCCATGCATGCGGCGAGCGGGAAGGTGGGTGTTGCCAGCTTGCAGGGCCAGGGTCGCATTGCCGCCGAA
AAGCGGGTGACGGTGTCCTCGTCTCAGGGGGCGGTCAATGTGCAAGCGAAGGAGCATGTGCTGTTGAACG
CGGCCGGGGCCCAGATCCGGGTGCTTGGGAACACGATTGAGGTGCATGCGCCGGGGATGACTACGTTTAA
GGGGGCGCAGCATTTGTTTGTGGGGCCGGGGGGGCGTGAAGCAAATACGAGCCTGCCCAAGGGCGAGCTA
CCCTTGTGCGAGTATCAGGCGATGGGGGCTGAATCGACCGGTGCCGGCATCGTTCCGATTCAGTCCTGA
 Primer design