SecReT6
Protein ID: 194291783
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1025
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1073696..1074787 [+]
Producthypothetical protein
NoteTssA
UniProt IDB3R9Q8
KEGG IDcti:RALTA_B1025
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.10E-25, Aligned region: 56..115
ImpA-rel_N [PF06812], Evalue: 9.10E-25, Aligned region: 156..180
ImpA-rel_N [PF06812], Evalue: 9.10E-25, Aligned region: 231..248
Protein Sequence: 363 a.a.     [Download]
>gi|194291783|ref|YP_002007690.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MASLQFDRLLAPLPGDQPCGEDLLFSAEFDRIQEARRADDPSLDQGDWVTDIKEADWREVIGIATSLLQD
RTKDLRLAVWLTEALSKERGFAGLRDGYQLTAELCGQYWDHLHPVMEADDVDYRTGSVTWLAGRSSQLIR
EIPLVDESAGGYTYVDWEVATHLAEAIRRDPEQADELAQGKTSQEQFEAARKKTPVAFYTALHADLVSCE
AALKHLGDVLDERVGEHAPSFRQAREALEAVRMLVERFVGKPAERAAGAEPSQASSSSAQSGHASAPAGA
ADAVHSGPIRTRAQALAQLREVADFFRRTEPHSPVAYLAARAAKWGDMPLHAWLRTVVKDDATLSQIEEL
LGVDENRSSDDAG
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1073696-1074787 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGCATCCCTCCAGTTCGACCGCCTGCTTGCTCCGCTTCCTGGCGACCAGCCCTGCGGCGAAGACCTGC
TGTTTTCCGCTGAATTCGACCGCATCCAGGAGGCGCGCCGCGCTGACGATCCTTCGTTGGACCAGGGCGA
TTGGGTTACGGATATCAAGGAGGCAGACTGGCGCGAGGTGATCGGCATCGCCACCTCGCTGCTGCAGGAT
CGCACCAAGGACCTACGCCTGGCGGTGTGGTTGACCGAGGCCCTTTCCAAGGAGCGGGGTTTTGCCGGGC
TGCGCGACGGCTACCAGCTGACGGCCGAACTGTGTGGCCAATATTGGGATCACCTGCATCCGGTAATGGA
AGCCGACGATGTCGATTACCGTACCGGCAGCGTGACGTGGCTGGCGGGGCGGTCGAGCCAGTTGATTCGC
GAGATTCCACTGGTCGATGAATCGGCGGGTGGATATACCTACGTCGACTGGGAGGTAGCGACGCACCTCG
CGGAAGCGATTCGTCGCGATCCGGAGCAGGCGGACGAACTGGCACAGGGCAAGACCAGCCAGGAGCAATT
CGAGGCGGCGCGCAAGAAGACGCCTGTGGCATTCTATACGGCACTGCATGCGGACCTGGTGTCCTGCGAA
GCAGCGCTGAAGCACCTCGGCGATGTGCTGGACGAGCGGGTCGGCGAGCATGCGCCCAGCTTCCGGCAGG
CGCGAGAAGCGCTGGAGGCGGTGCGTATGCTGGTGGAGCGTTTTGTCGGCAAGCCGGCGGAACGGGCAGC
CGGCGCGGAGCCCAGTCAGGCATCGTCCTCGTCGGCGCAGAGCGGACATGCAAGCGCGCCGGCCGGCGCT
GCCGACGCCGTGCACTCCGGCCCGATTCGCACGCGTGCCCAGGCGCTGGCCCAATTGCGCGAGGTCGCGG
ATTTTTTCCGACGCACGGAGCCGCACAGCCCCGTGGCTTACCTGGCGGCGCGTGCCGCCAAGTGGGGCGA
CATGCCGCTGCACGCGTGGCTCCGTACGGTGGTCAAGGACGATGCCACGCTGTCGCAGATCGAGGAATTG
CTCGGTGTGGACGAAAATCGTTCGAGCGACGACGCAGGCTGA
 Primer design