SecReT6
Protein ID: 194291785
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1027
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1075767..1076585 [-]
Productouter membrane protein; ompa/motb domain
NoteTagL
UniProt IDB3R9R0, B3R9R0
KEGG IDcti:RALTA_B1027
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.20E-22, Aligned region: 117..121
OmpA [PF00691], Evalue: 3.20E-22, Aligned region: 170..264
BON [PF04972], Evalue: 0.00024, Aligned region: 44..81
BON [PF04972], Evalue: 0.00024, Aligned region: 112..132
Protein Sequence: 272 a.a.     [Download]
>gi|194291785|ref|YP_002007692.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MVGTRTPALAAGLLAALVMLPGHAAPGDPGTTATPAASAAAPSGRVVAGGAVPDEATKASVLARLRELYG
SANVVDQIEVGNVVSPPNWSGNVQKILSPQIKQVSRGQLSIDGTQVSVHGDVRNEAQRQQIASDMATGLG
QSYTVKNGLRVPASEQNLLDQTLANRIIEFETGAATLTPKGRAILDEMAAVLPRLSGRKIEIVGHTDNSG
SRALNLTLSQARAETVKNYLIGKGGEPGMLTAVGVGPDQPVAPNDKEEGRAKNRRIEFRAGQ
 
Nucleotide Sequence: 819 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1076585-1075767 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
GTGGTTGGAACACGCACGCCTGCACTGGCTGCGGGCCTGCTGGCCGCGCTGGTCATGCTGCCCGGCCATG
CCGCGCCCGGCGATCCCGGCACCACCGCCACGCCTGCCGCGTCTGCAGCGGCACCTTCAGGCCGCGTCGT
CGCAGGCGGCGCGGTCCCCGACGAAGCCACCAAGGCAAGTGTGCTGGCGCGCCTGCGTGAGCTGTATGGC
AGCGCCAACGTGGTGGACCAGATCGAAGTCGGCAACGTGGTCTCGCCCCCGAACTGGTCGGGCAATGTGC
AGAAGATCCTCTCGCCGCAAATCAAGCAGGTCAGCCGCGGCCAGCTGAGCATCGATGGCACGCAGGTATC
CGTGCACGGCGACGTGCGCAACGAGGCCCAGCGCCAGCAGATCGCCAGCGACATGGCCACCGGCCTGGGC
CAGAGCTATACGGTGAAGAACGGCCTGCGCGTGCCCGCTTCCGAACAGAACCTGCTGGACCAGACCCTGG
CCAACCGGATCATCGAATTCGAAACAGGCGCCGCCACGCTGACGCCCAAGGGCCGCGCCATCCTCGATGA
AATGGCCGCGGTGCTGCCGCGCCTGAGCGGACGCAAGATCGAGATTGTCGGCCACACGGACAACTCCGGC
AGCCGCGCGCTGAACCTGACGCTAAGCCAGGCACGCGCCGAGACCGTGAAGAACTACCTGATCGGCAAAG
GCGGCGAGCCCGGCATGCTGACGGCAGTGGGGGTGGGACCGGACCAGCCCGTGGCACCGAATGACAAGGA
GGAAGGGCGGGCGAAGAACCGGAGGATCGAGTTCCGGGCGGGGCAGTAG
 Primer design