SecReT6
Protein ID: 194291787
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1029
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1077628..1081584 [-]
Producthypothetical protein
NoteTssM
UniProt IDB3R9R2
KEGG IDcti:RALTA_B1029
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-71, Aligned region: 81..105
ImcF-related_N [PF14331], Evalue: 2.20E-71, Aligned region: 186..446
IcmF-related [PF06761], Evalue: 2.00E-53, Aligned region: 491..857
DUF1215 [PF06744], Evalue: 3.40E-28, Aligned region: 992..1107
Protein Sequence: 1318 a.a.     [Download]
>gi|194291787|ref|YP_002007694.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MHRILNFLSHTRTLSVFGVVVLTVFLLLMAQTFEIGLAWVAIVLGVLLLAWLATYLWKRWRARRASGKLE
GILEQQADMAAKAAPPDKRDEVEALRTRLASAVKTIKTSKLGQMSGSEALYELPWYIVIGNPAAGKSTAV
LNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYAVHEEDRREWLGFLDLLKRYRPKAPIN
GIVVTVSIPELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDNEKQERDR
VWGATLPFAPEERRDVAAVFDQRFDELCDGLKEISVAQIAQHRNGKLSPGLLSFPLEFASVKPTLRAFLV
TLFDENPFQYKPVFRGFYFTSAVQEASTTSVSAERIARRFGLKLEGVAGSREVFSKNGFFLRDLFSKVIF
ADRRTVRQFASPAKTRLRFATFFGLVLVLGLLLGGWTWSFLGNRQLTANVQADLDKIVKMQQNRVDLQAR
LEALDILQDRIEQLERFRADHPLALSLGLYQGDTLQHKLLDEYYNGLRQVMLKPVGSAIETFLAEVNAHP
EQLAPMVRPPETGAVVATSLPAAAPASAAAATATMPAATPAAGKRYTDASPTNVEDAYNALKTYLMLADK
RHVEVAHLTDQMTRFWRGWLEDNRGNMPREQLIRSAERNLSFFLARVNDDNWPLLEGNLSLIDQSRENLR
RVVRGMPARERAYAEIKARASTRFAPMTVARIVGDTGASVVAASYAVPGTFTREAWLGYVQPAIREAASK
ELQSKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAREWQRFMQGVTIQDFGSFEQAVASMNLLGDP
ANSPIRKVLDTAYEQTSWDNPSLLNAGLKQAKSGMLDWFKRLISRGTPSQVSVNVDVSGANTGAGTIPMG
PVGKEFSGLARIVVMHDNNSMLRGYMESLSKVRTRFNQLKNQGDPGPGARQLMQQTLDGNGSELADALKY
VDEQMMTGLTDSQRQALRPLLVRPLLQSYAVVIRPASVEINKVWNAQVYQPFSQTLATKYPFASDAKIEA
SAAEIGQIFGPEGAIAKFTTATIGPLSVRRGDMLAARTWGDLGLTLAPEFTTNFTRWVAPLTGGAAGGSG
GATAAAAQQTVFQILPTPATGTTEYTIEIDGQQLRYRNTPAQWANFVWPNPQGSPGAKITATTFDGRSVE
LLNEPGRFGLERLIATAARKRRPDGAFDLTWSRDNIAVSVALRIISSPQTAGNASASDSPQSQGLRGLRL
PTAIADANAPLNAATPPAASPSTSPAAPPSAPPAPNPQASAQGNAQASAQVNQGGTAQ
 
Nucleotide Sequence: 3957 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1081584-1077628 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGCATCGCATCCTTAACTTCCTGAGCCACACACGCACGCTGTCGGTATTCGGCGTGGTCGTGCTGACCG
TCTTCCTGTTGCTGATGGCGCAGACCTTCGAAATCGGGCTGGCGTGGGTCGCCATCGTCCTGGGCGTGTT
GTTGCTGGCGTGGCTGGCCACCTACTTGTGGAAGCGCTGGCGTGCGCGCCGGGCCAGCGGCAAGCTCGAG
GGCATCCTCGAGCAGCAGGCCGACATGGCCGCCAAGGCCGCGCCGCCCGACAAGCGCGACGAGGTCGAAG
CGCTGCGCACGCGCCTGGCCAGCGCCGTGAAGACTATCAAGACCTCCAAGCTGGGCCAGATGTCGGGCAG
CGAGGCGCTCTACGAGTTGCCCTGGTACATCGTGATCGGCAACCCCGCGGCGGGCAAGAGCACGGCGGTG
CTGAACTCGGGCCTGCAGTTTCCGTTCGCCGACAAGAACAGCGCCGTGATCCACGGCATTGGCGGCACGC
GCAACTGCGACTGGTTCTTCACCACCGAAGGCATCCTGCTCGATACCGCGGGCCGCTATGCCGTGCATGA
AGAAGACCGGCGCGAATGGCTAGGCTTCCTGGACCTGCTCAAGCGCTACCGGCCCAAGGCGCCGATCAAC
GGCATCGTGGTCACGGTCAGCATTCCGGAACTGACGCAGAACCGGCCCGAGTTCGCCATCAACCTGGCCA
AGAACCTGCGCCAGCGCGTGCAGGAGCTGACCGAGCGGCTGGAAGTGTTCGCGCCGGTCTATGTGATGTT
CACCAAGGCCGACCTGATCACCGGCTTTACCGAATTCTTCGGCGACAACGAGAAGCAGGAGCGCGACCGC
GTCTGGGGCGCCACACTGCCCTTCGCCCCCGAAGAGCGGCGCGATGTGGCGGCCGTGTTCGACCAGCGCT
TCGACGAACTGTGCGACGGCCTGAAAGAGATCAGCGTGGCGCAGATCGCGCAGCACCGCAACGGCAAGCT
GTCGCCCGGGCTGCTGAGCTTTCCGCTCGAGTTTGCCTCGGTCAAGCCCACGCTGCGCGCCTTCCTGGTC
ACGTTGTTCGACGAGAACCCGTTCCAGTACAAGCCCGTGTTCCGCGGCTTCTACTTCACCAGCGCGGTAC
AGGAGGCCAGCACCACCAGCGTCTCGGCCGAGCGCATCGCGCGCCGTTTCGGGCTCAAGCTGGAAGGCGT
GGCCGGCAGCCGCGAGGTGTTCTCGAAAAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGGTGATCTTC
GCCGACCGCCGCACCGTGCGCCAGTTTGCCAGCCCCGCCAAGACGCGGCTGCGCTTCGCGACCTTCTTCG
GGCTGGTGCTGGTGCTAGGGCTGCTGCTGGGCGGCTGGACCTGGTCGTTCCTCGGCAACCGGCAGCTGAC
CGCCAACGTGCAGGCGGACCTGGACAAGATCGTCAAGATGCAGCAGAACCGCGTCGACCTGCAGGCGCGG
CTGGAAGCGCTGGACATCCTGCAGGACCGCATCGAGCAGCTGGAACGCTTCCGCGCCGACCATCCGCTGG
CGCTGTCGCTGGGCCTGTACCAGGGCGACACGCTGCAGCACAAGCTGCTGGACGAGTACTACAACGGCCT
GCGCCAGGTGATGCTGAAGCCAGTCGGTAGCGCTATCGAGACCTTCCTGGCCGAAGTCAACGCGCATCCC
GAGCAGCTTGCGCCGATGGTGCGCCCGCCGGAAACCGGCGCAGTCGTCGCGACCTCGCTGCCCGCGGCAG
CGCCTGCGTCGGCCGCAGCCGCCACGGCAACGATGCCCGCCGCCACGCCCGCCGCGGGCAAGCGCTACAC
CGATGCCTCCCCCACCAACGTGGAAGACGCGTACAACGCGCTCAAGACCTACCTGATGCTGGCGGACAAG
CGCCACGTCGAGGTGGCGCACCTGACTGACCAGATGACCCGCTTCTGGCGCGGCTGGCTGGAAGACAACC
GCGGCAACATGCCGCGCGAGCAGCTGATCCGTTCGGCCGAGCGCAACCTGTCGTTCTTCCTGGCCCGCGT
CAACGACGACAACTGGCCGCTGCTGGAAGGCAACCTGTCGCTGATCGACCAGTCCCGCGAAAACCTGCGC
CGTGTGGTGCGCGGCATGCCAGCGCGCGAGCGCGCCTATGCCGAGATCAAGGCCCGCGCTTCCACCCGCT
TTGCCCCGATGACGGTGGCCCGCATCGTGGGCGACACCGGCGCCTCCGTGGTCGCCGCCAGCTACGCCGT
GCCGGGCACCTTCACGCGCGAGGCGTGGCTAGGATACGTGCAGCCCGCCATCCGTGAGGCCGCCAGCAAG
GAACTGCAGAGCAAGGACTGGGTGCTCAACGTAGCCGCACGCGACGACCTGACCCTGGAAGGCAGTCCCG
AGCAGATCCAGAAAACGCTGGTCACGATGTACAAGACCGAATACGCGCGGGAATGGCAGCGCTTCATGCA
GGGGGTGACGATCCAGGATTTCGGCAGCTTCGAACAAGCCGTGGCCAGCATGAACCTGCTGGGGGACCCG
GCCAACTCGCCGATCCGCAAGGTGCTGGACACCGCTTATGAGCAGACCTCGTGGGACAACCCGTCGCTGC
TCAATGCCGGCCTGAAGCAGGCCAAGTCCGGCATGCTCGACTGGTTCAAGCGCCTGATTTCGCGTGGCAC
GCCCTCGCAAGTGAGCGTCAATGTCGATGTCAGCGGCGCGAATACCGGCGCCGGCACCATCCCGATGGGC
CCGGTCGGCAAGGAGTTCTCGGGCCTGGCGCGCATCGTCGTCATGCATGACAACAACTCGATGCTGCGCG
GCTATATGGAGTCGCTGTCGAAGGTGCGCACGCGCTTCAACCAGCTTAAGAACCAGGGCGATCCCGGCCC
CGGCGCGCGCCAGCTGATGCAGCAGACGCTGGACGGCAATGGCTCGGAGTTGGCCGATGCGCTGAAGTAT
GTCGACGAGCAGATGATGACCGGGCTCACCGACAGCCAGCGCCAGGCGCTGCGGCCACTGCTGGTGCGCC
CGCTGCTGCAGTCCTACGCCGTGGTCATCCGCCCGGCCAGCGTGGAGATCAACAAGGTGTGGAACGCACA
GGTGTACCAGCCGTTCAGCCAGACCCTGGCGACCAAGTATCCGTTTGCCTCGGATGCCAAGATCGAAGCC
AGCGCGGCAGAGATCGGGCAGATCTTCGGGCCGGAGGGCGCGATCGCCAAGTTCACCACCGCCACCATCG
GCCCCCTGTCGGTGCGCCGCGGCGACATGCTGGCCGCACGCACCTGGGGCGACCTGGGCCTGACGCTGGC
GCCGGAGTTCACAACCAACTTCACGCGCTGGGTGGCGCCGCTGACCGGCGGCGCGGCAGGCGGCAGTGGC
GGCGCCACGGCCGCGGCGGCGCAGCAGACGGTGTTCCAGATTCTGCCGACGCCCGCGACCGGCACCACCG
AGTACACCATCGAGATCGACGGCCAGCAGCTGCGCTATCGCAATACGCCGGCGCAGTGGGCCAACTTTGT
CTGGCCTAACCCGCAGGGTTCGCCGGGCGCGAAGATCACGGCAACGACCTTCGATGGACGTTCCGTCGAG
CTGCTTAACGAGCCCGGCCGCTTCGGCCTCGAGCGCCTGATCGCGACCGCTGCGCGCAAGCGCCGCCCGG
ATGGCGCCTTCGACCTGACATGGAGCCGCGACAATATCGCGGTCAGCGTGGCGCTGCGCATCATCAGCAG
CCCGCAGACTGCGGGCAATGCCAGCGCTTCCGACTCGCCGCAAAGCCAGGGGCTGCGCGGCCTGCGCCTG
CCGACCGCGATCGCTGACGCCAATGCGCCGCTCAATGCAGCTACGCCGCCGGCCGCTTCGCCGTCGACTT
CCCCCGCGGCGCCTCCGTCCGCCCCCCCTGCCCCGAACCCGCAGGCCAGCGCGCAGGGCAACGCGCAGGC
CTCGGCCCAAGTCAACCAAGGAGGTACGGCGCAATGA
 Primer design