SecReT6
Protein ID: 194291789
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1031
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1083195..1083464 [-]
Producthypothetical protein
NotePAAR
UniProt IDB3R9R4
KEGG IDcti:RALTA_B1031
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 9.00E-26, Aligned region: 8..82
DUF4150 [PF13665], Evalue: 0.0025, Aligned region: 46..74
Protein Sequence: 89 a.a.     [Download]
>gi|194291789|ref|YP_002007696.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MARPFILLGDKTDHGGVVITASGNTTTNGRGIACVGDRVTCPRSGHGGTTVIVTGDPNVIIDGRAAARHG
DKTACGATLLSSQGLTGSA
 
Nucleotide Sequence: 270 bp     [Download]
>gi|188591847|ref|NC_010530.1|:c1083464-1083195 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
GTGGCACGTCCTTTCATTCTGCTGGGCGACAAGACCGACCACGGCGGCGTGGTGATCACCGCCTCGGGCA
ATACCACCACCAATGGCCGGGGCATTGCGTGCGTGGGGGATCGTGTCACCTGCCCTCGTTCAGGCCATGG
CGGCACCACCGTCATCGTCACCGGCGACCCCAACGTCATCATCGACGGCCGTGCCGCCGCGCGGCACGGC
GACAAGACCGCTTGTGGCGCAACCTTGCTGTCCAGCCAGGGCTTGACCGGCAGCGCATGA
 Primer design