SecReT6
Protein ID: 194291792
SecReT6 ID267
T6SS typei4b
Gene symbol-
Locus tagRALTA_B1034
StrainCupriavidus taiwanensis LMG 19424
Repliconchromosome II [GenBank: NC_010530] [Browse all T6SS(s) in this replicon]
Location [Strand]1085672..1088968 [+]
Producthypothetical protein
NoteTssI
UniProt IDB3R9R7
KEGG IDcti:RALTA_B1034
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.40E-57, Aligned region: 37..359
Phage_GPD [PF05954], Evalue: 7.40E-57, Aligned region: 474..544
DUF2345 [PF10106], Evalue: 1.80E-36, Aligned region: 38..58
DUF2345 [PF10106], Evalue: 1.80E-36, Aligned region: 772..932
T6SS_Vgr [PF13296], Evalue: 2.20E-34, Aligned region: 618..728
Phage_base_V [PF04717], Evalue: 6.10E-19, Aligned region: 458..556
Protein Sequence: 1098 a.a.     [Download]
>gi|194291792|ref|YP_002007699.1| unnamed protein product [Cupriavidus taiwanensis LMG 19424]
MDVTTLYQHLFSAAHRLYALEGEGVLGELAVEAWIGREGVSALAESRIVVVSANADIPLDSLLGQRVTLL
TTLAGGGQSRRTGLIRQAEKLGAYGGLARYRLTVVPWLWLTTQQRNSQVFQNRKLDSIIEAVLQPYAPHA
QWRYAAGAEARIAAIGERAHVAQFRETDYQFLSRLLAEAGLGYTVVEDEEAPSGHAVVIFADSAQLPEDE
ESAAGGGIRFHRAHSQESADAIQQLACETRATVGGVAVTAWDPEAKRAIRGHAPARYVGNAGRAVSPDPY
LSVSLSLAPDGASAQRVAEQVMEAVEARALLFTGRASVRTLRSGMRLTVNGCPHLPLQEDDAAGYPLLLD
AVEHCGINNLAADTRAALADRIGPLEAALCFDAPPAAPDAPEATPGLLGVLPDHEPVRLAPSQALQTAAR
EQGYAAIFRAIDARRPWRACVLDVDCPRLYSRSKPLGVHSAIVVGPDGQSQAHGNAEHHASPAGEICVRF
HWQRGERADDRSSRWIRVAQRQAGAGMGWQWLPRIGQEVLVKFADDDIDQPFVIGALYNGQGEAGHAPTP
GGKSAATGSDSQSLYAQGTDSAPSAQGNLAGGNSPAWHGLGAQPDGHRNAAALTGFKSQEHGGKGYNQLV
LDDSDGQLRTQLATTLQSTQLNLGHLIHQQDNRRGSFRGQGFELRTDGHAAVRGEAGLLLTTYRDAATGR
ALPTGDNAAGIALLRQASDLVKTLSQGATAHQTQALSTGKDGDAPLPKQAQAASGMVDGQALEAARDDAS
SGNTTTPGKVPHQAAAMVHLNGRAGLTLVAGQDLQIANGESVALASGLDSSIAVAGQARVHAGQAIGVAA
GLSGAGDNNIGLQLTAGQNDIDIQAQHDLLKLAARDDLTVVSANMNVDFAAAKRIRIATAGGASILIEGG
NITVECPRAITYKAAQRKFEGPVNTAYPLPEFPQAPMPYKPMEFRMRLANTPGEGGHALAYAPWKIAVGE
APLGLGMVADDELVAHGVTDADGNVVLSQTQQEAVARAYCASPANTWLVYPGPTVRVHVAEQDPAWTDAE
AARHALNAGDFSGGLPQSMSDDNTQQRLRYARDALAAGSSNQIYKKTQ
 
Nucleotide Sequence: 3297 bp     [Download]
>gi|188591847|ref|NC_010530.1|:1085672-1088968 Cupriavidus taiwanensis LMG 19424 chromosome 2, complete sequence
ATGGATGTAACCACTCTTTACCAGCATCTTTTCAGCGCGGCTCACCGGCTGTATGCCCTGGAAGGTGAGG
GCGTGCTGGGCGAACTCGCCGTCGAAGCCTGGATCGGCCGGGAAGGCGTTTCCGCGCTGGCCGAGTCGCG
CATCGTCGTGGTCAGCGCCAACGCCGATATCCCATTGGACAGCCTGCTTGGCCAGCGGGTCACATTGCTG
ACCACGCTCGCCGGCGGCGGCCAGTCGCGCCGCACCGGCCTTATCCGACAGGCCGAGAAGCTCGGCGCCT
ACGGGGGCCTGGCGCGATATCGCCTGACAGTGGTGCCGTGGCTGTGGCTGACCACGCAGCAGCGCAACAG
CCAGGTGTTCCAGAACCGCAAGCTCGACAGCATCATCGAGGCCGTGCTGCAGCCCTATGCGCCGCACGCG
CAATGGCGCTACGCGGCCGGCGCCGAGGCGCGCATTGCCGCCATCGGCGAGCGTGCCCATGTCGCGCAGT
TCCGCGAAACCGACTACCAGTTCCTGTCGCGCCTGCTGGCAGAGGCCGGCCTGGGCTATACCGTCGTGGA
AGACGAGGAAGCCCCCAGCGGGCATGCGGTGGTGATCTTTGCCGACAGCGCGCAATTGCCGGAAGACGAA
GAATCCGCGGCAGGCGGCGGCATCCGCTTCCATCGCGCGCACAGCCAGGAATCGGCCGATGCCATCCAGC
AGCTGGCGTGCGAGACCCGTGCGACTGTGGGCGGCGTGGCCGTGACGGCATGGGACCCGGAGGCCAAGCG
AGCGATCCGCGGCCACGCGCCGGCACGTTATGTCGGCAATGCCGGCCGGGCGGTGAGCCCGGATCCGTAC
CTGTCCGTCAGCCTGTCATTGGCGCCCGACGGCGCGAGCGCGCAGCGCGTTGCCGAGCAGGTGATGGAAG
CCGTCGAAGCCCGCGCGCTACTGTTCACCGGTCGGGCGTCCGTGCGCACGCTGCGCAGCGGCATGCGCCT
GACCGTCAATGGCTGCCCGCACCTGCCGCTGCAGGAAGACGACGCTGCTGGATATCCGCTGCTGCTCGAT
GCGGTGGAGCATTGCGGCATCAACAACCTGGCCGCCGACACACGCGCTGCGCTGGCGGATCGCATTGGGC
CGCTCGAGGCAGCCTTGTGTTTCGACGCACCCCCAGCGGCACCCGACGCACCGGAGGCAACACCCGGGCT
GCTGGGCGTGCTACCGGACCACGAGCCAGTGCGCCTGGCCCCTTCGCAAGCCCTGCAGACGGCAGCACGC
GAACAGGGCTACGCGGCGATCTTCCGCGCCATCGACGCCCGCCGCCCATGGCGTGCCTGTGTCCTTGACG
TCGATTGTCCGCGTCTTTACAGCCGGTCCAAGCCGTTGGGGGTACACAGCGCGATCGTCGTCGGCCCTGA
CGGCCAGTCCCAGGCCCATGGCAACGCCGAACACCACGCCAGCCCAGCCGGCGAGATCTGCGTGCGCTTC
CACTGGCAGCGCGGCGAGCGCGCCGACGACCGCAGCAGCCGCTGGATCCGCGTCGCACAGCGCCAGGCCG
GCGCCGGCATGGGCTGGCAGTGGCTGCCGCGCATCGGGCAGGAAGTGCTGGTCAAGTTCGCCGACGACGA
CATCGACCAGCCTTTCGTCATCGGCGCGTTGTACAACGGCCAGGGTGAAGCGGGCCACGCACCCACGCCC
GGCGGCAAGAGCGCCGCGACGGGCAGCGACAGTCAGTCCCTGTACGCTCAGGGCACCGACAGCGCCCCCA
GCGCGCAAGGCAACCTCGCCGGGGGCAACAGCCCCGCCTGGCACGGACTGGGCGCGCAGCCAGACGGCCA
TCGCAATGCCGCCGCGCTGACGGGTTTCAAGAGCCAGGAACACGGCGGCAAGGGCTACAACCAGCTGGTG
TTGGACGACAGCGACGGCCAGCTGCGCACGCAACTGGCCACCACGCTGCAGTCGACCCAGCTCAATCTTG
GCCACCTGATCCACCAGCAGGACAACCGCCGTGGCAGCTTCCGCGGCCAGGGCTTCGAGTTGCGCACCGA
CGGCCACGCCGCCGTGCGCGGCGAGGCAGGGCTGCTGCTAACCACCTACCGCGACGCGGCTACCGGCCGT
GCGCTGCCCACCGGCGATAACGCCGCCGGCATCGCGCTGCTGCGGCAGGCGAGCGACCTGGTCAAGACCC
TGAGCCAGGGCGCGACCGCGCACCAGACGCAGGCGCTGTCGACCGGCAAGGATGGCGACGCCCCTTTGCC
GAAGCAGGCCCAGGCTGCGTCCGGCATGGTCGACGGACAAGCGCTGGAAGCGGCCAGGGACGATGCATCC
AGCGGCAACACGACGACTCCCGGCAAGGTTCCGCACCAGGCCGCGGCCATGGTCCACCTCAACGGCCGCG
CCGGGCTGACGCTGGTTGCCGGCCAGGACCTGCAGATTGCCAACGGCGAAAGCGTGGCACTGGCCAGCGG
CCTGGACAGCAGCATCGCGGTAGCTGGCCAGGCCCGCGTACACGCCGGACAGGCCATTGGGGTCGCGGCG
GGCCTGTCGGGCGCTGGGGACAACAATATCGGCCTGCAGCTGACGGCGGGGCAGAATGATATCGATATCC
AGGCGCAGCACGATTTGCTAAAGCTGGCGGCACGGGACGACCTGACCGTGGTGTCGGCCAACATGAACGT
GGATTTCGCCGCGGCGAAACGGATCCGCATTGCCACGGCGGGCGGAGCGTCGATACTGATCGAGGGCGGG
AATATTACGGTGGAGTGCCCACGGGCGATTACTTACAAGGCGGCGCAGAGGAAATTCGAGGGGCCGGTGA
ATACTGCCTACCCGCTCCCCGAATTTCCGCAAGCCCCGATGCCTTACAAGCCCATGGAATTCCGCATGCG
GCTGGCAAATACCCCGGGCGAAGGCGGGCACGCGCTGGCTTACGCGCCCTGGAAGATCGCTGTGGGCGAA
GCGCCGCTGGGACTCGGCATGGTGGCTGACGACGAACTGGTGGCACATGGCGTTACCGACGCGGATGGCA
ACGTGGTACTCAGCCAGACCCAGCAGGAAGCCGTGGCGCGCGCCTATTGCGCCAGTCCAGCCAATACCTG
GTTGGTATATCCCGGGCCGACTGTTCGCGTGCACGTTGCCGAGCAGGATCCGGCCTGGACGGACGCGGAG
GCGGCCCGCCACGCACTCAATGCCGGTGACTTCAGTGGTGGGCTACCGCAATCGATGTCGGATGACAATA
CGCAGCAACGGCTGCGCTATGCCCGCGATGCGCTAGCTGCAGGATCGTCCAACCAGATCTACAAAAAAAC
TCAGTAA
 Primer design