SecReT6
Protein ID: 197119416
SecReT6 ID296
T6SS typei4a
Gene symbol-
Locus tagGbem_3045
StrainGeobacter bemidjiensis Bem
Repliconchromosome [GenBank: NC_011146] [Browse all T6SS(s) in this replicon]
Location [Strand]3511412..3514813 [-]
Producttype VI secretion system protein IcmF-like domain-containing protein
NoteTssM
UniProt IDB5E878
KEGG IDgbm:Gbem_3045
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-52, Aligned region: 179..415
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 113..188
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 804..866
Protein Sequence: 1133 a.a.     [Download]
>gi|197119416|ref|YP_002139843.1| type VI secretion system protein IcmF-like domain-containing protein [Geobacter bemidjiensis Bem]
MKKETILICCKYVLFASAFCPFLVIAFVMFPLLTWSWRIGAFLPFFALALWGTLVLIKKGVLLARGRRQA
PAAVNPPQPGKEGEAQDPLADLQQHWAGGLEILRRSHLSREGNPLYVLPWFLVLGEAGSGKSAALKDARL
CSPFPGTEQGTAPTSSCRWVFYDQGVLLDTAGRYAVPAAAERDDAEWRRLLWLLKKYRHEDPLNGVILTL
PADKLARGAQEELENYARALRARIDEMIRLLGINFPVYLLITKSDLIEGMEPFCAALPASTLNQPMGLAK
EELSTGLSLFMERFSLGLDEALRRLRLILLQHREAGAGAASLLLPDRIRGLYAPLNAFVQAAFGANHYQE
TPLLRGIYFCSANPAKTPLASGEPSPSAHPLFLHEFFEKVLPGDRGLWAPGAQALKRQRVVLNWALTGWG
LTGLALCLMLSYSFAKNIRVIRDASQLVSRTQELQGTVPIDLPAMGRLSGMISEVEQQNREWWVPRFGLN
RSKEIELELKARFCSGFRDRFLVFFDRSLADTVSSFSPSTPDQLFGTCVMHLSRRCNLLKARLEGENSQL
LASRPLPDYPLILLPQQAGGPAFGNLYLDYLNWRADREGINKELEWLQLLLKQAYLVKGSDLSWLLEFVD
RLHPEAAITLQQFWGGSRPLPQEPAIPPSLTAKGSERIRSMLAQIAAAHPEPGILAREKGEFEARYRAAC
FTAWQRFAWEFPKGDQRLVAPKEWRYVAANMASDKGPYLSFMRRALAELQPLAGAGHLPPWVMQMYRFQL
LRAAGPAAGVAASMAPAADGVAGRLQRLATRKGSGPDGVQGADVTREYLDALARVAPVAKSRSLALQMAR
EAFANTQEQSKSPLFLAADAAQRLNALLIQADGDDTFLRLVSGPIAFYGTFVRMETACELQAQWEEKVLK
EVQGANDAQTLQYLLGKDGPVWRYVGQFADPFLGWSPGRGYYARSALGGAVPFSTEFYAFLAKGAKTKIA
ASAPSRGSYQVTIKGLPTDANAEARVKPQGTRLELQCAAGSQVISNMNYPVSRPFVWSPDSCGDVLFHID
IGDTVLTRRYSGTRGFAAFLKDFPGGRHTFYPSHFPAEREALEKMGVRFIRVNYQIFGAGDIFEGQGETL
PGRVPQKVAECWD
 
Nucleotide Sequence: 3402 bp     [Download]
>ref|NC_011146.1|:c3514813-3511412 type VI secretion system protein IcmF-like domain-containing protein [Geobacter bemidjiensis Bem]
TTGAAGAAAGAGACCATCCTCATCTGCTGCAAGTACGTCCTTTTCGCCTCCGCCTTTTGCCCTTTCCTGG
TGATCGCGTTCGTGATGTTTCCGCTCCTCACCTGGTCCTGGCGTATCGGCGCCTTTTTACCGTTTTTTGC
CCTTGCCCTGTGGGGGACTTTGGTTCTGATCAAAAAGGGGGTGCTCCTGGCGAGGGGCCGGCGGCAGGCG
CCCGCAGCGGTGAACCCTCCGCAACCAGGCAAGGAAGGGGAGGCGCAGGATCCGCTCGCCGACCTGCAGC
AGCACTGGGCGGGCGGGCTGGAGATCTTGCGGCGGTCGCACCTGAGCCGGGAGGGAAACCCGCTCTACGT
GCTCCCCTGGTTCCTGGTACTTGGCGAGGCGGGATCCGGAAAGAGTGCCGCCCTCAAGGACGCCCGGCTT
TGCTCCCCATTCCCCGGGACGGAGCAGGGTACGGCGCCGACCAGCAGTTGCCGCTGGGTGTTCTACGACC
AGGGGGTGCTGCTGGACACAGCCGGGAGATACGCCGTCCCGGCGGCAGCGGAGCGAGACGATGCGGAGTG
GCGCCGGCTTCTGTGGCTGTTGAAGAAATACCGGCACGAAGATCCTCTCAACGGCGTGATCCTGACCCTC
CCCGCGGACAAACTGGCAAGGGGGGCGCAAGAGGAACTGGAGAACTATGCGCGTGCGCTGCGAGCTCGAA
TCGATGAAATGATCCGCCTGCTCGGGATCAACTTCCCGGTCTACCTCCTGATCACCAAATCCGACCTGAT
CGAGGGGATGGAGCCGTTTTGCGCGGCACTCCCCGCCTCGACGCTCAATCAGCCCATGGGGCTGGCGAAG
GAGGAACTGTCGACCGGCCTGTCCCTGTTCATGGAACGTTTCTCCCTGGGGCTCGACGAAGCGTTGAGGC
GCCTGCGCCTGATCCTTTTGCAGCACAGGGAAGCTGGAGCCGGCGCCGCGAGCTTGCTGCTCCCCGACCG
GATCCGGGGCCTGTACGCTCCGCTGAACGCCTTCGTGCAGGCGGCATTCGGGGCAAACCACTACCAGGAG
ACGCCCCTGCTGCGCGGCATCTACTTTTGCAGCGCCAACCCTGCGAAAACCCCGCTGGCGTCCGGCGAGC
CTTCCCCATCCGCACATCCGCTTTTCCTGCATGAGTTTTTCGAGAAGGTTCTCCCTGGCGACCGGGGGCT
GTGGGCTCCGGGAGCGCAGGCCCTAAAACGGCAGAGGGTGGTGCTTAATTGGGCACTCACTGGGTGGGGC
CTGACCGGACTCGCATTGTGCCTGATGCTGAGCTATTCCTTCGCGAAAAACATAAGGGTGATTCGGGACG
CGTCACAGCTGGTGTCGCGCACGCAGGAACTGCAGGGAACGGTCCCGATTGATTTGCCGGCAATGGGACG
TTTGAGCGGCATGATTTCCGAGGTCGAGCAGCAGAACCGGGAGTGGTGGGTCCCGCGGTTTGGCCTCAAT
CGCAGCAAAGAGATCGAGTTGGAGCTTAAAGCCCGCTTTTGCAGCGGCTTCCGCGACCGCTTCCTGGTTT
TTTTCGACCGCAGCCTTGCCGATACCGTTTCCAGTTTTTCCCCCAGTACCCCGGACCAGCTCTTTGGAAC
CTGCGTGATGCACCTCAGCCGACGCTGCAATTTGCTGAAGGCTCGGCTCGAAGGGGAGAACTCGCAACTG
CTGGCGTCACGGCCGCTCCCCGACTACCCGTTGATATTGCTGCCCCAGCAAGCCGGCGGCCCCGCCTTTG
GAAACCTCTACCTCGACTACCTCAATTGGCGCGCCGATCGCGAAGGGATCAACAAGGAGCTGGAGTGGCT
GCAATTGCTGCTGAAACAGGCCTACCTCGTGAAGGGAAGCGACCTTTCCTGGCTTTTGGAGTTCGTGGAC
CGCCTGCACCCCGAGGCGGCGATAACGCTGCAGCAGTTTTGGGGCGGGTCACGGCCGCTGCCGCAAGAGC
CGGCGATCCCCCCGTCGCTGACTGCCAAAGGAAGCGAGCGGATCCGCTCGATGCTCGCTCAGATAGCTGC
CGCTCATCCCGAGCCGGGGATACTGGCTAGGGAGAAGGGAGAATTCGAGGCTAGGTACCGCGCCGCCTGT
TTCACCGCGTGGCAGCGGTTCGCCTGGGAATTCCCCAAAGGGGACCAGCGCCTGGTGGCGCCCAAGGAGT
GGCGCTATGTCGCTGCCAACATGGCGAGTGACAAAGGTCCGTACCTCAGTTTCATGAGGAGGGCCCTGGC
GGAACTTCAGCCTCTGGCCGGCGCCGGCCATCTTCCCCCCTGGGTGATGCAGATGTACCGTTTCCAGCTG
TTAAGGGCAGCGGGACCTGCTGCCGGCGTCGCAGCCTCAATGGCACCCGCGGCCGACGGCGTAGCCGGCC
GCCTGCAGAGGTTGGCAACCAGGAAGGGTAGCGGTCCGGACGGGGTTCAGGGCGCCGATGTGACCAGGGA
ATATCTTGATGCGTTGGCTCGCGTTGCCCCTGTCGCAAAATCAAGATCGCTCGCGCTCCAGATGGCGCGG
GAGGCGTTCGCCAACACTCAGGAACAAAGCAAGTCTCCTCTTTTCCTTGCCGCCGATGCCGCTCAGAGGC
TAAACGCCCTCCTGATCCAGGCCGATGGCGACGACACTTTCTTGCGACTGGTTTCCGGGCCCATCGCCTT
TTACGGGACCTTCGTCAGGATGGAGACCGCTTGCGAGCTGCAGGCCCAGTGGGAAGAGAAAGTGCTGAAG
GAAGTGCAGGGGGCAAACGACGCCCAGACGCTGCAATACCTCTTGGGCAAGGACGGCCCTGTCTGGCGTT
ATGTCGGCCAGTTCGCTGATCCATTTCTCGGGTGGAGCCCCGGACGCGGTTACTATGCCCGGTCCGCCCT
GGGGGGTGCGGTTCCCTTCAGCACCGAGTTCTATGCCTTCCTGGCCAAAGGAGCGAAAACGAAGATCGCT
GCCTCCGCCCCCTCAAGGGGGAGCTACCAGGTCACCATCAAGGGGCTTCCCACCGACGCCAACGCTGAGG
CGCGCGTGAAGCCGCAGGGGACCCGGCTCGAACTGCAATGCGCGGCCGGTTCGCAGGTGATCTCCAACAT
GAACTACCCCGTGAGCAGGCCCTTCGTCTGGTCGCCCGACAGTTGCGGCGACGTGCTGTTCCACATCGAT
ATCGGCGACACGGTCCTCACCAGGCGTTATTCCGGGACCCGCGGGTTTGCCGCATTCCTTAAAGATTTCC
CCGGCGGCAGGCACACCTTTTACCCCAGCCACTTTCCAGCCGAACGCGAGGCTTTGGAGAAAATGGGGGT
CCGCTTCATCAGGGTGAACTACCAGATCTTCGGCGCCGGCGACATCTTTGAAGGGCAAGGGGAGACGCTC
CCCGGACGGGTACCCCAGAAGGTAGCGGAGTGCTGGGATTGA
 Primer design